KEGG   Jonesia denitrificans: Jden_0807Help
Entry
Jden_0807         CDS       T00972                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
jde  Jonesia denitrificans
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:jde00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
869205..870071
Genome map
AA seq 288 aa AA seqDB search
MAIVNRTTDSFWSGARQWDIDVALRAVEDAVTHGADIVDIGGVRAGVGPPISVDEEIGRV
VPFIHQVCQLFPDTAFSVDTYRAPVAQAAAQAGVHIINDTWAGHDPNLVTVAATYHLGLV
CSHTGGLLPRTDPYRVAYPRRIDQATAAGPDNGDPRDGVLDDVLATVLATANRAEQAGVP
PESLLIDPTHDFGKNTWHSLHLVRATQQLVATGYPVLMALSRKDFVGETLGLGPDERLEG
TLAATAVAAWNGAKVFRAHDVKETRRVLDMVAALRGDILPQRVTRATN
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atggcaattgtgaacagaaccaccgattccttttggtctggcgcacgccaatgggacatt
gatgtggcactgcgggcggtggaggatgctgtcacccatggagctgacattgtggacatc
ggtggcgttcgcgcaggtgtgggcccacccatcagtgtggacgaggaaatcggccgtgtt
gttcccttcatacaccaggtgtgtcagctatttcctgacacggcgttttccgtggatacc
taccgtgcccctgtcgcccaggccgccgcacaggccggcgttcacatcattaatgacacc
tgggctgggcacgaccccaaccttgtgactgttgctgccacatatcaccttggccttgtg
tgttcccacaccggtggattgcttccccgaactgacccctatcgagtcgcttacccacgt
cggatcgaccaggccaccgccgcagggccagacaacggcgatccacgtgatggcgtcctc
gacgatgtcctggcaaccgtcctcgccacagcgaaccgtgcagaacaagcaggagtgccg
cccgaatctcttctgatcgacccgacccacgacttcgggaaaaatacgtggcactcactt
catcttgtccgggcaacacaacaactcgtcgccaccggctatcccgttctgatggcgctg
tcgcgaaaagactttgtcggtgaaacactcggcctcggccctgacgaacgcctcgagggt
accttggcggcaactgctgtggctgcctggaacggcgccaaggtctttcgggcgcatgac
gtcaaagaaacgaggcgagtcctggatatggtggcggcattacgaggagatatcctcccc
cagcgtgtgacaagggccacaaactag

DBGET integrated database retrieval system