KEGG   Jonesia denitrificans: Jden_0829Help
Entry
Jden_0829         CDS       T00972                                 

Definition
pyrimidine-nucleoside phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
jde  Jonesia denitrificans
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:jde00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Jden_0829
Enzymes [BR:jde01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Jden_0829
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
891294..892589
Genome map
AA seq 431 aa AA seqDB search
MTTHLFDTVDVIRAKRDGRELTSEEIAWVIDAYTHDHVADYQMAALNMAILLNGMTRREI
ADWTRAMIESGERMNFDQLSRPTADKHSTGGVGDKITLPLAPLVAVFDVAVPQLSGRGLG
HTGGTLDKLEAIAGWRAALTNDEMMHQLDTVGAVICQAGSGLAPADRKLYALRDVTGTVE
AIPLIASSIMSKKIAEGTSALVLDVKVGSGAFMKNVDQARELARTMVDLGTDAGVTTTAL
LTDMSTPLGLTVGNALEVRESIEVLAGGGPADVVDLTVALAAEMLAGAGKTTAEDDIRAA
LNDGRAMDAWRAMIAAQDGDNDAALPVAAEQHVITAPRSGYLTTLDAYAVGVASWRLGAG
RARKDDQVQAGAGIELHAKPGDKVTAGAPLMTLHTDTPERFDRAIEIAEEGVVISDDAPT
NSPSLIIDRLA
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgaccacccacctcttcgacactgttgatgtcatccgggccaagcgtgatggacgtgaa
ctgaccagcgaagaaatcgcctgggtcatcgatgcctacacccacgaccacgtggccgat
taccaaatggctgccctgaacatggccatcttgctcaacggcatgacccgccgggaaatc
gctgactggacccgggcgatgatcgaatcaggcgaacgcatgaactttgatcagttgtcc
cgccccaccgcggacaaacactccaccggcggagtgggagacaaaattactctcccattg
gcacccctcgttgccgtgtttgacgtggccgtcccccaactgtctgggcgtggactgggg
cacactggtggcacgctcgacaaactcgaagcgatcgccgggtggcgcgctgcactcacc
aacgacgaaatgatgcaccaactggacacggtgggggcggtgatctgccaagcgggttca
ggtcttgcaccagcggaccggaagctgtacgcactgcgcgatgtcacgggaaccgttgaa
gcgatcccactgattgcatcgtcaatcatgagcaaaaaaatcgcagaaggaacgtctgcg
ctggttcttgacgtcaaagtcggctccggggcatttatgaaaaatgtggaccaagcacgg
gaactcgcccggacaatggtggatctggggaccgacgctggtgtaacaacaactgcgcta
ctcaccgacatgtccacgccgctcggactcaccgttggaaatgcccttgaggtgcgtgaa
tccattgaggtgttggccggaggcggccctgcagatgttgttgatctgacagttgccctc
gcagcagaaatgctcgctggagctgggaagacaaccgcagaagacgacatccgcgcagca
ctgaacgatggtcgtgcgatggatgcgtggcgtgccatgatcgcagcgcaagatggtgac
aatgatgcagcattgcccgtggcagcagagcagcatgtcatcaccgctccgcgcagtggg
tacctcaccacccttgacgcatacgcggtcggtgtcgcctcgtggcggctcggtgcaggc
cgcgcccgaaaagacgatcaggttcaagccggtgccggaattgaactgcatgcaaagcca
ggggacaaggtaacggcaggagccccactgatgactctgcacaccgacaccccagaacgg
ttcgaccgtgcgatcgagatcgctgaggaaggtgttgtgatcagtgatgacgcaccaacc
aactcgccatcgctcattatcgaccggctcgcatga

DBGET integrated database retrieval system