KEGG   Jonesia denitrificans: Jden_0941Help
Entry
Jden_0941         CDS       T00972                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
jde  Jonesia denitrificans
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:jde00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Jden_0941
Enzymes [BR:jde01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Jden_0941
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
992522..994672
Genome map
AA seq 716 aa AA seqDB search
MDQGEQLNTVCDTYRVERPHRSVPSSAIVRVLGAFGIDISTPGQLAVAAAACADEPWRTM
APPMVVADRPSVHVPIHVFAGDPVSVTLDANGTQVHLTPARGHTTDVETRRVDGVVVERR
MYALPTSLPVGFAHLTVTSEGRSQRSLIIVPPMPSARSHTHKDNDTNRDIGMSWELGALA
SDRSWGIGDWLDARDVAGWAHTMGAQYVYPDPHRLSPQQRWDQPTDGVTFLDPLYLRVED
IDEYAYLSTPDRTLVTWAKDDPAVTRGLRAGNLDDIARAKVRAARVIFNAGLSPARRYQF
DAFCVQGGRHLRVYAAWCALVRYSDNPWNPDRFFSLSDPQLNDTAAHFAPDVEFFMWLQW
ILTRQLAAVHRQLSWHTFGLARPLWLHAAKGSIEEWFVRGTVISGTRNAPGVDTVANTVV
CNPLDTERSGLVQLRATVRRVAQHCGAIVIQDPQAFFTSRLTADGHTITIRHDARSRIAA
VITEAALAGVHVWANDRDLTQEQRQELTAAGIVVRTMVLGDAGVDASALGRDRDAGRIEC
VSTWATGPLAARLDGTDLHAVTDVADIGHTPTRQSERAFHRRQLATAVGADPEKNPTAWS
LVTDVYRRVAQRGLTDIHLADALGVSTLSVSVGSPTQSVDARSPLSDFPVVLGGYRDSGG
ALLSVDDVWNSARAAYLVNSLTRGVITDAVSPRQKNTQDAPTEVSESTPPSTRSPA
NT seq 2151 nt NT seq  +upstreamnt  +downstreamnt
gtggatcaaggcgagcaactgaacacggtgtgcgacacgtaccgggtggaacgaccccat
aggtctgttccatcatcggcgattgtccgcgttcttggtgcgttcgggatcgacatcagt
acaccaggccaactggccgtcgcggccgcggcctgcgcagacgaaccatggcgcaccatg
gcaccccccatggtcgttgctgaccgcccaagtgttcacgtccccatccacgttttcgca
ggagacccagtcagcgtcacactcgacgccaatggcacccaggttcacctcacacccgcc
cgcggtcacacaaccgacgtcgaaactcgacgagtagacggagtcgttgtcgaacgtcgc
atgtacgcactccccacctccctacccgttggtttcgcccatctcaccgtgaccagtgag
ggacgatcgcaacgcagcctcattatcgtgccacctatgccctccgctcgatctcacacc
cacaaagacaacgacaccaaccgtgacatcggaatgtcctgggaacttggtgccttggct
agtgaccgtagttggggaatcggtgactggcttgacgcgcgcgacgttgcagggtgggca
cacaccatgggtgcccagtacgtctatcccgatccgcaccggctatcgccccaacaacgg
tgggatcaaccaaccgacggcgtcacattccttgaccccttgtatcttcgagttgaagac
attgatgaatacgcgtacctgtccacaccagaccgcacccttgtcacgtgggcaaaagac
gatccggcagtcacgagagggctacgcgccggcaacctcgatgacatcgctcgcgccaaa
gtgcgggctgcacgagtcattttcaacgccgggttatcaccagcccgcaggtaccaattt
gacgctttctgcgtccaaggcggacgtcacctgcgggtctacgcagcctggtgtgcactc
gtccgttattcagataacccgtggaaccctgatcgtttcttctccctctccgacccgcaa
ctcaacgacacagcggcacacttcgcccccgatgttgagttcttcatgtggttgcaatgg
atcctcacccgacaactggctgcggtccaccgccaactgtcgtggcacaccttcgggctc
gcccgacccctgtggctccatgcagccaaaggcagcatcgaagagtggtttgtccgagga
acagtgatcagtggaacacgaaacgcccccggtgttgacactgttgccaacactgtcgtg
tgcaacccccttgatactgaacgcagcggactggtgcaactgcgcgcaactgtgcgtcga
gttgcacaacactgcggagcaatagtcatccaagaccctcaagcgttcttcacctcacgt
ctcacagccgacggtcacaccatcaccatccggcacgacgcacgctcccgcatagccgcc
gtcatcaccgaagctgccctagctggggtccacgtatgggctaacgaccgtgatctgact
caggagcagcgacaagagctgacagcagcgggcatcgtggtaagaactatggtcttgggc
gacgccggcgtggatgccagcgccctagggcgcgatcgtgatgctgggcgcatcgaatgt
gtgtccacatgggcaacaggaccattggctgcccgtcttgatggcaccgacctccacgcg
gtcacggacgtggctgatattggtcacacacccacacgccaatcagagcgagcgtttcac
cgccgtcagttggcaaccgcggttggggcggacccagagaagaatcccacagcatggtcg
ctcgtcacagacgtgtaccgtagggttgcccagcgtgggctgacagacatccaccttgcc
gatgcgctcggagtgtcaacactgtcagtgtcagttggatcaccaacacaatccgttgat
gcgcgaagcccgcttagtgacttccctgttgtccttggcgggtaccgtgacagtggtggg
gcgctgctcagcgtggacgatgtgtggaatagtgcccgtgccgcttaccttgtgaactca
ctgacgcgcggagtaatcactgatgcggtctctccgcgtcagaagaacacgcaggatgca
ccaactgaggtctccgagtcaacacctccatccacacggtcaccggcgtag

DBGET integrated database retrieval system