KEGG   Jonesia denitrificans: Jden_1031Help
Entry
Jden_1031         CDS       T00972                                 

Definition
Dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
jde  Jonesia denitrificans
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:jde00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:jde00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1094859..1095434
Genome map
AA seq 191 aa AA seqDB search
MTTSLAAKPQLSLIWAQSLNGVIGRSGTIPWHEPTDLAHFQKTTRGGVVIMGRHTWESLP
VTPLPQRVNIVLTSDRDYRAPGARVVTTPQQALDLAHWYTQVGHQAIWVIGGRQVYDTFM
DYATQLIVTTVGTVIEGDTEAPRIPPHFVPQEPHQLATHSDYEVTVTTWLRTASPLTSPR
LSRDHVKDTVD
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgacaacgtccttagcggccaagcctcagctctccctgatttgggcccagagtctcaat
ggtgttattgggcgaagcggaacaattccgtggcatgaacctaccgacctcgcgcacttc
caaaagacaactcggggtggtgttgtcattatggggcgacacacctgggagtcactacct
gtcacgccgctacctcaacgagtcaatattgtgctcacctcagaccgtgactaccgcgcc
cctggagcgcgggtggtgacaaccccacaacaagccctagatttggctcactggtacacg
caggttgggcaccaggcaatttgggtgatcggcgggcgtcaggtgtatgacaccttcatg
gactatgcaacacaactcattgtcacaactgtgggtaccgtgatcgaaggagacactgaa
gcaccccgcattcccccacattttgtcccgcaagaaccgcaccaacttgccactcattcc
gattatgaggtgactgtgacaacatggcttcgaacagcaagcccactcacctctccacgc
ttgtcgcgtgaccacgtcaaggacacggtagattaa

DBGET integrated database retrieval system