KEGG   Jonesia denitrificans: Jden_1216Help
Entry
Jden_1216         CDS       T00972                                 

Definition
(GenBank) tryptophan synthase, beta subunit (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
jde  Jonesia denitrificans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:jde00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Jden_1216
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Jden_1216
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Jden_1216
Enzymes [BR:jde01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Jden_1216
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1294918..1296162
Genome map
AA seq 414 aa AA seqDB search
MATSLQNMPGPFFGEFGGRFMPEALIAALDELDEVYSKAKRDPEFERELSSLHRTYSGRP
SIITEVPRFAQHAGGVRVFLKREDLNHTGSHKINNVLGQALLTKRVGKKRVIAETGAGQH
GVATATAAALFDLDCVIYMGEEDTQRQALNVARMRLLGAEVIPVTTGSRTLKDAINEALR
DWVTNVDTTNYVFGTAAGPHPFPAMVRDFQRIIGVEARAQMLEETGRLPDVVAACVGGGS
NAIGIFDAFVDDESVRLVGLEAGGEGIDTGRHASTISGGAPGVLHGAKSYLLQDDDGQTQ
ESHSISAGLDYPGVGPQHAYLHSIGRAEYRSITDAQAMDALRLLSRTEGIIPAIESAHAL
AGALELGQQAARDGRNDEVILVNLSGRGDKDVATAARWFQLVDDNADLTEGGAQ
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
gtggccacgtcactgcaaaatatgcccggcccgttcttcggggagtttggtgggcgattt
atgcctgaagctctcatcgcagctctcgatgagctcgacgaggtgtacagcaaggcgaag
cgtgacccagagtttgagcgggaactcagctctcttcaccgaacatactcaggccgcccg
tcgattatcactgaggttccccggttcgcgcagcacgctgggggtgtgcgggtgttcctc
aaacgtgaggatctcaaccacactggctcccacaaaatcaacaatgtgctcggtcaagct
cttctcaccaagcgggtgggtaagaaacgagtcattgctgaaactggtgctgggcaacac
ggcgtggcaaccgctaccgcggcggcactgttcgatttggactgtgtcatctacatgggt
gaagaagacacccagcgtcaagctctgaacgtcgctcggatgagactgctcggtgcggaa
gtgatccccgtaaccacggggtcgcgcaccctgaaggatgcgattaacgaagctctgcgt
gactgggtgaccaacgtggacaccaccaactatgtctttggaactgcagcagggccacat
cccttccccgcaatggtgcgtgacttccaacggatcatcggtgtcgaagcgcgcgcgcaa
atgctggaagagactgggcggctccctgacgtcgttgctgcatgcgtgggcggtgggtcc
aacgctatcggaatattcgatgcatttgtggacgacgaatccgttcgtcttgttggcctt
gaagcaggcggggaagggatagatactggacggcacgcctcgacgatctcgggaggtgca
cccggagtgcttcatggggcgaaatcttatcttcttcaagacgacgatgggcagactcaa
gagtcacactcaatttctgcaggtctcgactacccgggtgtgggaccacagcacgcctac
cttcactccatcgggcgagccgagtaccggtcaatcactgacgctcaagcgatggacgca
cttcggctgttgtcaagaactgaggggatcatccctgcaattgagtcagcgcatgctcta
gctggagctcttgagcttggacaacaggcggcccgtgacgggcgcaacgacgaggtcatc
ttggtgaatctgtcaggccgtggggacaaagacgtggcaacagcagcccggtggtttcaa
ctcgttgatgacaacgctgacctcactgaaggaggcgcacagtga

DBGET integrated database retrieval system