KEGG   Jonesia denitrificans: Jden_1217Help
Entry
Jden_1217         CDS       T00972                                 

Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
jde  Jonesia denitrificans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:jde00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Jden_1217
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Jden_1217
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Jden_1217
Enzymes [BR:jde01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Jden_1217
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1296159..1296983
Genome map
AA seq 274 aa AA seqDB search
MNSIVEQRLQQCRSEGRAALIGYFPVGYPSVEESIQAVTTLIDNGCDIIELGVPYSDPVM
DGPVIAAAVQHALDNGARLSHVFDVVRAVSGRGVPIVVMTYFNPIFHYGVERFAQDLAAA
GGAGVVTPDLTPDYAHDWIAAADAHHLDKIFLVAPSSTDERLHLTAQASRGFVYAASTMG
VTGERTTISDAAEELVHRTQQQGASYVCVGLGVSTPEQAARVGAYADGVIVGSAFVKALT
GESGQSLEERRETMGRIASAMATAIAGVRAQETS
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
gtgaacagcattgtggagcaaaggctgcaacagtgccgtagtgagggacgtgctgcgctc
attggttacttccccgtagggtatccctctgttgaggaaagcatccaagctgtcacgacc
ctcattgacaacggatgcgacattatcgagttaggtgtcccttactcagatccggtcatg
gatggtccagtcatcgctgcggccgttcagcatgcgcttgacaatggtgcgcggttatct
catgtgtttgatgttgtgcgggctgtctcgggacgcggtgtacccatcgttgtaatgaca
tatttcaacccgattttccattacggtgtcgaacgttttgctcaagatcttgcggcagca
ggtggggcaggagtggtgaccccagatctcactccggactatgcgcatgactggatcgct
gcagcagacgcgcaccatctcgacaagattttccttgttgcacctagttccactgatgaa
cgtcttcacctcaccgcacaagcgtcacgtggttttgtgtatgcggcctcgaccatgggg
gtcacaggggagcgcaccactatcagtgacgcagctgaggaactggttcaccgcacccag
cagcagggcgcatcgtacgtgtgtgttggcctaggcgtctcgacccctgagcaagcagca
cgagtaggtgcttacgctgacggggtcatcgtcgggtcagcattcgtgaaagcgttaaca
ggcgagagcggtcaatcactggaagaacgacgcgaaaccatggggcgtatcgcttctgcg
atggccacagcgattgctggcgtacgggcgcaggagacatcatga

DBGET integrated database retrieval system