KEGG   Jonesia denitrificans: Jden_1217Help
Entry
Jden_1217         CDS       T00972                                 

Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
jde  Jonesia denitrificans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:jde00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Jden_1217
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Jden_1217
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Jden_1217
Enzymes [BR:jde01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Jden_1217
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1296159..1296983
Genome map
AA seq 274 aa AA seqDB search
MNSIVEQRLQQCRSEGRAALIGYFPVGYPSVEESIQAVTTLIDNGCDIIELGVPYSDPVM
DGPVIAAAVQHALDNGARLSHVFDVVRAVSGRGVPIVVMTYFNPIFHYGVERFAQDLAAA
GGAGVVTPDLTPDYAHDWIAAADAHHLDKIFLVAPSSTDERLHLTAQASRGFVYAASTMG
VTGERTTISDAAEELVHRTQQQGASYVCVGLGVSTPEQAARVGAYADGVIVGSAFVKALT
GESGQSLEERRETMGRIASAMATAIAGVRAQETS
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
gtgaacagcattgtggagcaaaggctgcaacagtgccgtagtgagggacgtgctgcgctc
attggttacttccccgtagggtatccctctgttgaggaaagcatccaagctgtcacgacc
ctcattgacaacggatgcgacattatcgagttaggtgtcccttactcagatccggtcatg
gatggtccagtcatcgctgcggccgttcagcatgcgcttgacaatggtgcgcggttatct
catgtgtttgatgttgtgcgggctgtctcgggacgcggtgtacccatcgttgtaatgaca
tatttcaacccgattttccattacggtgtcgaacgttttgctcaagatcttgcggcagca
ggtggggcaggagtggtgaccccagatctcactccggactatgcgcatgactggatcgct
gcagcagacgcgcaccatctcgacaagattttccttgttgcacctagttccactgatgaa
cgtcttcacctcaccgcacaagcgtcacgtggttttgtgtatgcggcctcgaccatgggg
gtcacaggggagcgcaccactatcagtgacgcagctgaggaactggttcaccgcacccag
cagcagggcgcatcgtacgtgtgtgttggcctaggcgtctcgacccctgagcaagcagca
cgagtaggtgcttacgctgacggggtcatcgtcgggtcagcattcgtgaaagcgttaaca
ggcgagagcggtcaatcactggaagaacgacgcgaaaccatggggcgtatcgcttctgcg
atggccacagcgattgctggcgtacgggcgcaggagacatcatga

DBGET integrated database retrieval system