KEGG   Jonesia denitrificans: Jden_1228Help
Entry
Jden_1228         CDS       T00972                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
jde  Jonesia denitrificans
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:jde00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Jden_1228
   01230 Biosynthesis of amino acids
    Jden_1228
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Jden_1228
   00030 Pentose phosphate pathway
    Jden_1228
   00051 Fructose and mannose metabolism
    Jden_1228
   00052 Galactose metabolism
    Jden_1228
  Energy metabolism
   00680 Methane metabolism
    Jden_1228
Enzymes [BR:jde01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Jden_1228
Protein phosphatases and associated proteins [BR:jde01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Jden_1228
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1312101..1313123
Genome map
AA seq 340 aa AA seqDB search
MRIGLLTGGGDCPGLNAAIRAVVKQALGEYGHQVIGFRNGWKGVVDGDVIQLDRSNIRNI
LPQGGTMLGTARFHPHSAGAMDQVMATFEAERIDAVICIGGDGTLNAASKVAEQGINVIA
IPKTIDNDVWGTDLSIGYHTAVNIATEAIDRIHTTAESHNRVMVVEVMGRHAGWIAVASG
IAGGAEIVLAPEEPFDIERIVKFLRHRHRAHANFSIVVVAEGAEPAKGSAMDYEVQLGQF
GEIIAGAVGERVAHEIQERTGFDTRLTVLGHVQRGGTPTPTDRILGSRFGVAAVDAVTAG
KTNVMTALHNEEVVLVPLEDIAGKVKPVPEDLLRVARVLA
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgcgtatcggtctgctcaccggtggtggtgactgccccggtttgaacgccgcgatccgt
gcagttgttaaacaagcccttggagaatatgggcaccaagtcattggttttcgaaacggg
tggaaaggcgtcgttgatggcgatgtcatccaactcgaccgatccaatatccgtaatatc
cttccgcaaggtggaacaatgctgggaacagcccggttccacccgcattcggcaggtgcc
atggaccaggtgatggcgacgtttgaggccgaacgtatagacgctgtcatctgcatcggt
ggtgacggaacactgaacgccgcctcgaaagttgcggaacagggcattaatgtcattgcg
atccccaagacgatcgacaacgacgtgtggggaacggacctgtcaattggttaccacacg
gcagtgaacatagcgacagaagcgatcgaccgtatccacaccacagcagaatcacataac
cgtgtcatggtcgttgaggtaatgggacgtcatgccgggtggattgctgttgcctcaggt
attgctggtggagcggaaattgtgcttgctcccgaagaaccttttgacatcgaacggatc
gtcaagttcttgcgccaccgtcaccgtgcgcacgcgaacttctcgatcgttgtggtcgcg
gaaggcgccgagccagcgaagggctcagctatggactacgaagttcaactcggccagttc
ggggagatcatcgccggagcagtgggggagcgagtcgcccacgaaatccaagaacgtacc
gggttcgatacccgcctgaccgttcttggacacgtgcaacgcggtgggacacccacacca
acagaccgcatccttgggtcacgttttggtgttgcagctgttgatgccgtcacagcagga
aaaaccaacgtcatgaccgccttgcacaacgaagaggtcgtgcttgtcccgctggaagac
attgcaggaaaggtgaaacctgttcctgaagatctgttgagggtcgctcgcgtccttgcg
taa

DBGET integrated database retrieval system