KEGG   Jonesia denitrificans: Jden_1228Help
Entry
Jden_1228         CDS       T00972                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
jde  Jonesia denitrificans
Pathway
jde00010  Glycolysis / Gluconeogenesis
jde00030  Pentose phosphate pathway
jde00051  Fructose and mannose metabolism
jde00052  Galactose metabolism
jde00680  Methane metabolism
jde01100  Metabolic pathways
jde01110  Biosynthesis of secondary metabolites
jde01120  Microbial metabolism in diverse environments
jde01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:jde00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Jden_1228
   00030 Pentose phosphate pathway
    Jden_1228
   00051 Fructose and mannose metabolism
    Jden_1228
   00052 Galactose metabolism
    Jden_1228
  Energy metabolism
   00680 Methane metabolism
    Jden_1228
Enzymes [BR:jde01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Jden_1228
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Jden_1228
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat Peripla_BP_1
Motif
Other DBs
NCBI-ProteinID: ACV08884
UniProt: C7R427
Position
1312101..1313123
Genome map
AA seq 340 aa AA seqDB search
MRIGLLTGGGDCPGLNAAIRAVVKQALGEYGHQVIGFRNGWKGVVDGDVIQLDRSNIRNI
LPQGGTMLGTARFHPHSAGAMDQVMATFEAERIDAVICIGGDGTLNAASKVAEQGINVIA
IPKTIDNDVWGTDLSIGYHTAVNIATEAIDRIHTTAESHNRVMVVEVMGRHAGWIAVASG
IAGGAEIVLAPEEPFDIERIVKFLRHRHRAHANFSIVVVAEGAEPAKGSAMDYEVQLGQF
GEIIAGAVGERVAHEIQERTGFDTRLTVLGHVQRGGTPTPTDRILGSRFGVAAVDAVTAG
KTNVMTALHNEEVVLVPLEDIAGKVKPVPEDLLRVARVLA
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgcgtatcggtctgctcaccggtggtggtgactgccccggtttgaacgccgcgatccgt
gcagttgttaaacaagcccttggagaatatgggcaccaagtcattggttttcgaaacggg
tggaaaggcgtcgttgatggcgatgtcatccaactcgaccgatccaatatccgtaatatc
cttccgcaaggtggaacaatgctgggaacagcccggttccacccgcattcggcaggtgcc
atggaccaggtgatggcgacgtttgaggccgaacgtatagacgctgtcatctgcatcggt
ggtgacggaacactgaacgccgcctcgaaagttgcggaacagggcattaatgtcattgcg
atccccaagacgatcgacaacgacgtgtggggaacggacctgtcaattggttaccacacg
gcagtgaacatagcgacagaagcgatcgaccgtatccacaccacagcagaatcacataac
cgtgtcatggtcgttgaggtaatgggacgtcatgccgggtggattgctgttgcctcaggt
attgctggtggagcggaaattgtgcttgctcccgaagaaccttttgacatcgaacggatc
gtcaagttcttgcgccaccgtcaccgtgcgcacgcgaacttctcgatcgttgtggtcgcg
gaaggcgccgagccagcgaagggctcagctatggactacgaagttcaactcggccagttc
ggggagatcatcgccggagcagtgggggagcgagtcgcccacgaaatccaagaacgtacc
gggttcgatacccgcctgaccgttcttggacacgtgcaacgcggtgggacacccacacca
acagaccgcatccttgggtcacgttttggtgttgcagctgttgatgccgtcacagcagga
aaaaccaacgtcatgaccgccttgcacaacgaagaggtcgtgcttgtcccgctggaagac
attgcaggaaaggtgaaacctgttcctgaagatctgttgagggtcgctcgcgtccttgcg
taa

DBGET integrated database retrieval system