KEGG   Jonesia denitrificans: Jden_1258Help
Entry
Jden_1258         CDS       T00972                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
jde  Jonesia denitrificans
Pathway
jde00010  Glycolysis / Gluconeogenesis
jde00051  Fructose and mannose metabolism
jde00562  Inositol phosphate metabolism
jde01100  Metabolic pathways
jde01110  Biosynthesis of secondary metabolites
jde01120  Microbial metabolism in diverse environments
jde01130  Biosynthesis of antibiotics
jde01200  Carbon metabolism
jde01230  Biosynthesis of amino acids
Module
jde_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:jde00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Jden_1258
   00051 Fructose and mannose metabolism
    Jden_1258
   00562 Inositol phosphate metabolism
    Jden_1258
Enzymes [BR:jde01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Jden_1258
Exosome [BR:jde04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Jden_1258
  Exosomal proteins of bladder cancer cells
   Jden_1258
  Exosomal proteins of melanoma cells
   Jden_1258
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ACV08914
UniProt: C7R457
Position
1349299..1350081
Genome map
AA seq 260 aa AA seqDB search
MTNARTPLIAGNWKMNLDHNEAIHTVQKLAWALKDAQHDYNAVEATVLVPFTDIRSVQTL
VDSDKLGITYGAQDLSAQVSGAYTGEISPVFLSRLGVKYVAVGHSERRQYHGEDDALVNA
KTKNALAHDIAPIVCVGEPLEVRKAGDQVPFTLAQVDGAFADISAEDAVKVVVAYEPVWA
IGTGEVATPADAQEVAQAIRARLAELYSQDVADAVRVLYGGSVKSSSIKELMNEADVDGA
LVGGASLDPEEFAKIVHYQD
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
gtgaccaacgcacgtaccccgctcattgctggtaactggaaaatgaacctcgaccacaac
gaggcgattcacacagtccaaaagctcgcatgggcgttgaaagatgcacaacacgactac
aacgctgttgaggcgacagttttggtgcccttcaccgacattcgttccgtccagacactt
gttgactccgacaaactgggcatcacctacggtgcgcaggacctctccgcacaggtttct
ggtgcgtataccggtgaaatttcaccagtgttcctctcacgtcttggcgtgaagtatgtg
gctgtggggcactctgagcgccgccagtaccacggtgaagacgacgcccttgtgaacgca
aagaccaaaaacgcacttgcgcacgacattgcaccaatcgtgtgtgtgggggagcctctt
gaggttcgcaaagccggtgaccaagtgccgttcacacttgcacaggtcgatggtgcattt
gctgacatctcagctgaggacgccgtcaaggttgttgttgcctacgaacctgtgtgggca
atcggaactggcgaggttgcaacaccagcagatgcacaagaagtcgcccaggctattcgt
gctcggctggcggaactgtactcacaagacgtcgctgacgctgtccgcgtcctgtacggc
ggttctgtgaagtcatcgtcaatcaaggaactcatgaacgaagctgacgtcgatggggcc
cttgttggtggcgcttcgcttgacccagaagagttcgccaagattgtccactaccaggac
tga

DBGET integrated database retrieval system