KEGG   Jonesia denitrificans: Jden_1258Help
Entry
Jden_1258         CDS       T00972                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
jde  Jonesia denitrificans
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:jde00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Jden_1258
   01230 Biosynthesis of amino acids
    Jden_1258
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Jden_1258
   00051 Fructose and mannose metabolism
    Jden_1258
   00562 Inositol phosphate metabolism
    Jden_1258
Enzymes [BR:jde01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Jden_1258
Exosome [BR:jde04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Jden_1258
  Exosomal proteins of bladder cancer cells
   Jden_1258
  Exosomal proteins of melanoma cells
   Jden_1258
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1349299..1350081
Genome map
AA seq 260 aa AA seqDB search
MTNARTPLIAGNWKMNLDHNEAIHTVQKLAWALKDAQHDYNAVEATVLVPFTDIRSVQTL
VDSDKLGITYGAQDLSAQVSGAYTGEISPVFLSRLGVKYVAVGHSERRQYHGEDDALVNA
KTKNALAHDIAPIVCVGEPLEVRKAGDQVPFTLAQVDGAFADISAEDAVKVVVAYEPVWA
IGTGEVATPADAQEVAQAIRARLAELYSQDVADAVRVLYGGSVKSSSIKELMNEADVDGA
LVGGASLDPEEFAKIVHYQD
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
gtgaccaacgcacgtaccccgctcattgctggtaactggaaaatgaacctcgaccacaac
gaggcgattcacacagtccaaaagctcgcatgggcgttgaaagatgcacaacacgactac
aacgctgttgaggcgacagttttggtgcccttcaccgacattcgttccgtccagacactt
gttgactccgacaaactgggcatcacctacggtgcgcaggacctctccgcacaggtttct
ggtgcgtataccggtgaaatttcaccagtgttcctctcacgtcttggcgtgaagtatgtg
gctgtggggcactctgagcgccgccagtaccacggtgaagacgacgcccttgtgaacgca
aagaccaaaaacgcacttgcgcacgacattgcaccaatcgtgtgtgtgggggagcctctt
gaggttcgcaaagccggtgaccaagtgccgttcacacttgcacaggtcgatggtgcattt
gctgacatctcagctgaggacgccgtcaaggttgttgttgcctacgaacctgtgtgggca
atcggaactggcgaggttgcaacaccagcagatgcacaagaagtcgcccaggctattcgt
gctcggctggcggaactgtactcacaagacgtcgctgacgctgtccgcgtcctgtacggc
ggttctgtgaagtcatcgtcaatcaaggaactcatgaacgaagctgacgtcgatggggcc
cttgttggtggcgcttcgcttgacccagaagagttcgccaagattgtccactaccaggac
tga

DBGET integrated database retrieval system