KEGG   Jonesia denitrificans: Jden_1258Help
Entry
Jden_1258         CDS       T00972                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
jde  Jonesia denitrificans
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:jde00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Jden_1258
   01230 Biosynthesis of amino acids
    Jden_1258
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Jden_1258
   00051 Fructose and mannose metabolism
    Jden_1258
   00562 Inositol phosphate metabolism
    Jden_1258
Enzymes [BR:jde01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Jden_1258
Exosome [BR:jde04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Jden_1258
  Exosomal proteins of bladder cancer cells
   Jden_1258
  Exosomal proteins of melanoma cells
   Jden_1258
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1349299..1350081
Genome map
AA seq 260 aa AA seqDB search
MTNARTPLIAGNWKMNLDHNEAIHTVQKLAWALKDAQHDYNAVEATVLVPFTDIRSVQTL
VDSDKLGITYGAQDLSAQVSGAYTGEISPVFLSRLGVKYVAVGHSERRQYHGEDDALVNA
KTKNALAHDIAPIVCVGEPLEVRKAGDQVPFTLAQVDGAFADISAEDAVKVVVAYEPVWA
IGTGEVATPADAQEVAQAIRARLAELYSQDVADAVRVLYGGSVKSSSIKELMNEADVDGA
LVGGASLDPEEFAKIVHYQD
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
gtgaccaacgcacgtaccccgctcattgctggtaactggaaaatgaacctcgaccacaac
gaggcgattcacacagtccaaaagctcgcatgggcgttgaaagatgcacaacacgactac
aacgctgttgaggcgacagttttggtgcccttcaccgacattcgttccgtccagacactt
gttgactccgacaaactgggcatcacctacggtgcgcaggacctctccgcacaggtttct
ggtgcgtataccggtgaaatttcaccagtgttcctctcacgtcttggcgtgaagtatgtg
gctgtggggcactctgagcgccgccagtaccacggtgaagacgacgcccttgtgaacgca
aagaccaaaaacgcacttgcgcacgacattgcaccaatcgtgtgtgtgggggagcctctt
gaggttcgcaaagccggtgaccaagtgccgttcacacttgcacaggtcgatggtgcattt
gctgacatctcagctgaggacgccgtcaaggttgttgttgcctacgaacctgtgtgggca
atcggaactggcgaggttgcaacaccagcagatgcacaagaagtcgcccaggctattcgt
gctcggctggcggaactgtactcacaagacgtcgctgacgctgtccgcgtcctgtacggc
ggttctgtgaagtcatcgtcaatcaaggaactcatgaacgaagctgacgtcgatggggcc
cttgttggtggcgcttcgcttgacccagaagagttcgccaagattgtccactaccaggac
tga

DBGET integrated database retrieval system