KEGG   Jonesia denitrificans: Jden_1318Help
Entry
Jden_1318         CDS       T00972                                 

Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
jde  Jonesia denitrificans
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:jde00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Jden_1318
Enzymes [BR:jde01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Jden_1318
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1411519..1412070)
Genome map
AA seq 183 aa AA seqDB search
MAGPTAVGKGTVSADIRQRYPEVWLSVSVTTREPRPGEIDAVNYHFVGPDRFAEMVAGGE
LLEWAVVHGRHSYGTPRAQVEEQLLKDVPALLEIDLQGARQVKASMPDAQFIFLAPPSWD
ELVRRLTGRGTESAEEQQRRLATAKVELASQHEFDHVVINDDVHRATDEIISLMGLTPRP
VTQ
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atggcaggccccacagctgtcgggaaggggacggtgtcagcagacatccgacaacggtac
ccggaggtgtggctctcagtttcagtgacgacacgagagccacgccccggtgagattgac
gcagtaaactaccacttcgtcggtcctgaccgtttcgccgagatggttgcagggggtgaa
ctcctcgaatgggcagtggtccatggtcgtcatagttacggtaccccgcgcgcccaggtt
gaagaacaactgcttaaagacgttcccgcgctgctagaaatagacctccaaggtgcccgg
caagtaaaagcgtccatgccagatgcccaattcatttttcttgccccacccagttgggac
gaacttgtccggcgattgaccggacgtggaaccgagtcagctgaagaacaacaacgccgg
ctcgccacagcgaaagttgagttggcctcccagcacgaattcgaccacgttgtcatcaac
gacgacgttcaccgagcaaccgatgagatcatcagcctcatgggactcaccccacgaccc
gtcacacagtaa

DBGET integrated database retrieval system