KEGG   Jonesia denitrificans: Jden_1475Help
Entry
Jden_1475         CDS       T00972                                 

Definition
dihydrolipoamide dehydrogenase
Orthology
K00382  
dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
jde  Jonesia denitrificans
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Glycine, serine and threonine metabolism
Valine, leucine and isoleucine degradation
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:jde01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:jde00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:jde00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:jde00620]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:jde00260]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:jde00280]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1581037..1582422
Genome map
AA seq 461 aa AA seqDB search
MAETAGTDFDIVVLGGGSGGYAAALRAAQLGQNVALIEADKLGGTCLHYGCVPTKALLHA
AEVAESVREGHQFGVNATFNSIDMDGVNSYKANVINGLYKGLQGLIKSRKITVVEGYGKL
VGPNSVEVNGQRYNGKHVILATGSYSRTLPGLAIEGRVMTSDQALTLDYVPKSAIILGGG
VIGCEFASVWRSFGADVTIIEGLPHLVPNEDESISKALERAFRKRKINFNLGDLFSSVTQ
DDNGVHVTLQSGKTFDAEIMLVAIGRGPRTADLGYEEQGIRMDRGFVLTDDRLHTGVANI
WAVGDIVPGLQLAHRGFAQGIYVAEQILGLNPAPIVESGIPRVTYSEPEIASVGLTEKKA
QEEFGADNVETLDYNLAGNGKSKILATQGFIKLVRQKDGPVVGVHMIGSRVGELVGEGQL
IVNWEAYPEDVASLIHAHPTQNEALGEAFLALAGKPLHAHN
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
gtggccgaaaccgccggcaccgactttgacatcgtcgtcctgggtggagggagcggtggt
tacgccgccgcgctccgcgccgcacaactcggacagaacgtcgcactcatcgaagcagac
aaactcgggggcacttgccttcactatggttgtgtccccaccaaagcactcctccacgca
gctgaggtcgctgaatcagttcgtgagggtcaccaatttggggtcaacgctacgttcaac
tccatcgacatggacggcgtcaactcctacaaagccaacgtcattaacggcttgtacaaa
ggccttcaaggtctcattaagtcacgcaagatcaccgtagtcgaaggctacggaaaactg
gtaggccctaacagcgtggaggtcaacggccaacgctacaacgggaagcacgtcattttg
gccaccgggtcatactctcgtaccctgccaggacttgccatcgaaggtcgggtcatgacc
tccgaccaagccctcacgcttgactatgttcccaagtcagcaattatcttgggtggtggc
gtcatcgggtgtgagttcgcatctgtgtggcgttcctttggcgcggacgtcaccatcatt
gaaggactaccgcacctggtgcccaacgaagacgaatcgatctccaaggcgttggaacgt
gcgttccgcaaacggaaaattaacttcaaccttggcgacctgttctcctcagtcacccag
gacgacaacggtgttcacgtcaccctccaatcaggcaaaaccttcgatgcggagatcatg
ctcgttgcgatcggtcgtggaccacgcaccgctgaccttgggtacgaagaacaaggcatc
cgcatggaccgcggttttgtcctcacagatgacaggctccacacgggtgttgcaaacatt
tgggcagttggcgacatcgtgcccgggcttcaactagcgcaccgtggttttgcacaaggc
atctacgtggcggagcagattttgggtctcaaccctgcacccatcgtggaatccggtatc
ccacgtgtcacctattctgaacccgaaatcgcgtctgttgggttgaccgaaaagaaagct
caagaagagttcggcgccgacaacgtggaaacccttgactacaacctcgctggaaacgga
aagtcaaaaatccttgctacccaagggttcattaaactagtccgccaaaaagatgggcct
gtggtgggtgtccacatgattgggtcccgtgtcggagaactcgttggagaaggccaactc
attgtcaactgggaagcatacccagaggacgtggcttccctcattcacgcacaccccact
caaaacgaagccctcggcgaagcattcctcgctcttgccggcaagcccctgcacgcccac
aactga

DBGET integrated database retrieval system