KEGG   Jonesia denitrificans: Jden_1648Help
Entry
Jden_1648         CDS       T00972                                 

Definition
LPXTG-motif cell wall anchor domain-containing protein (EC:3.2.1.8)
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
jde  Jonesia denitrificans
Brite
Enzymes [BR:jde01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     Jden_1648
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1777913..1781353)
Genome map
AA seq 1146 aa AA seqDB search
MKLGHRTKGFAAAAAGVALVSTTFATAQAAPLTMEPAATDAVVVSEDFEEGLGVFGVRYG
NGSAPTVAVSTDYAASGVASAKVSDRDVNGDGIGLNPDGLLVAGGEYEFSANVRFAEGAE
GAVLSLGYKSDDGADVVYDGLIWDLPATSTEWSAVSGTFTLPDNVVEVHVETKYDSENTE
DFYIDDIVITDLSATDETGGETGGETGGETGGDTGEGDATGDTTSVTTSFEDGMGAWAQR
YGGDSSFTAELSEDFASDGTTSVKISGREFDGDGIGFDADGVLVEGKRYNYSFDVRFAPD
EPVGEITVSFFDGTDGYNTVQSVTNASNTGWTTVTGSYTIPSFEVPGALFYIETKYESGN
TSTFYVDNVSFAEATGLPVQDLTPLKSTVDIPVGVAIDERETSGLASELLLKHFDQITAE
NHMKPDYWYDDEGNWSGLHPEAKAMMDFAVANDLKVYGHVLVWHSQTPEWFFQDASGAPL
TDSAADQQILRDRMRTHIDNVAKAITDEYGPFGSATNPINAFDVINEVVSDSGEYADGLR
RSEWYRILGEEFIKLSFDYAEELLNGTYAASGVSNPVKLFINDYNTEQSGKQNRYYALVE
RLVAAGTPIDGVGHQMHVSLAMPVSALSGALDRFDEFGLLQAVTELDVTTGTPVTDAKLV
EQGYYYRDTFTMIREFAAETGRLWSATVWGLTDGRSWRVDDGAPILFDDDYQAKQAFYGA
IDSDELDPIIRTANVFQPSIDDVSVTSAEWDRLPMHDVEDAGFFQLRWGSDALTALVYVD
DPDAGAGDRVEFTLDGDTWSVNRDSDSVVEFDGYGWAFTTQFDVAGAAAGDTHDFDVRLV
NDGDTVGWNSPGATGILTLIEQLSYTTAIEADTAPQIDGVMDDVFADAQSITTGKQVSGT
DGATADTRAVWNGSTLYLFAEITDPDVDVTSASPWEQDSVEIYVDMGNAKNGSYRDLDTQ
IRISAQNVVSFGTGDEAMQEARITSATAATDTGYIVEVAIDLGDEGGAGTFQGFDFQVND
ASDGARASITNWADPTGAGYQSTARWGVIELLAADEDGDPVVPGEPNLPGSGGSGSDGAG
SDSDSGSDDGAAGSDTEDGDSDGLADTGANPLPIILGAILLALAGGAIVVLRRRLVGAQD
SDELTV
NT seq 3441 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgggccatcggacgaaggggtttgcagccgccgctgcaggagttgccctggtg
tccacgaccttcgcgaccgcacaagcggcgcctttaacaatggagccggccgccaccgac
gccgttgttgtttctgaagacttcgaagaaggactcggggtttttggagttcgatacggc
aacgggagcgcgccaaccgttgctgtcagcaccgactacgcggcatcaggtgttgcgtca
gccaaagtcagcgaccgtgatgtcaatggtgatggcattggactaaacccggacggcctt
ctcgtggctggaggtgaatacgagttttcggcaaacgttagattcgctgaaggggctgaa
ggcgcagtcttgagcctcggatataaatccgacgacggagccgatgttgtgtatgacggg
ttgatctgggatcttcctgctacatcaactgaatggtcggcagtttctggaacattcacg
ctgcctgacaatgtcgtcgaagttcatgtagagacgaagtatgactcggagaacaccgaa
gatttctacattgacgatatcgttatcactgatctgagtgcgacagacgagaccggtggc
gagaccggtggcgagaccggtggcgagaccggtggcgacactggggaaggtgacgcaact
ggtgacacgacctcagtgacaacaagcttcgaagacggcatgggtgcctgggcgcagcgc
tatggaggcgacagctccttcactgctgagctttccgaggactttgcctctgatggaacg
acgtcagtgaagatctcaggccgtgagttcgacggtgacgggatcggttttgacgctgat
ggggttcttgtcgagggtaagcgttacaactactcgtttgatgtgcggttcgcgcctgat
gagcccgttggtgaaatcaccgtgagtttctttgacggcacggatggctacaacaccgtt
cagtcggtcaccaacgcgtcgaacaccgggtggaccacggtgacgggcagctacacgatt
ccgagcttcgaagttccaggtgccctgttctacattgaaaccaaatacgagtcgggaaac
acctcgaccttctacgtggataacgtctctttcgctgaagcaactggtctccctgttcaa
gacctcaccccattgaagtccactgtggatattcctgttggtgtggcgattgatgagcgt
gaaaccagcgggttggcttctgagttgctgctcaagcactttgaccagatcacagctgaa
aaccacatgaagcccgattactggtatgacgatgagggcaactggtctgggctgcaccct
gaagcgaaagccatgatggatttcgcggtcgccaatgacctgaaggtttacggtcacgtg
ttggtgtggcactcccaaaccccggagtggttcttccaagacgcgagcggtgcaccgctc
acggatagtgcagcagaccagcagatccttcgggaccggatgcgcacgcacatcgacaat
gtggccaaagcgatcacagacgagtacgggccgtttggttcagcaacaaacccgatcaac
gcgtttgatgtcatcaacgaggtggtctcggactcgggtgagtacgctgatgggttgcgt
cggtctgagtggtaccgaattttgggtgaagagttcatcaaactgtcgtttgattacgct
gaggaactgctcaacggcacctatgcggcatcaggtgtgagtaacccggtgaaactgttc
attaacgactacaacacggaacagtcagggaagcagaaccgctactacgcactggttgaa
cggcttgtcgccgcgggcaccccaatcgatggggtagggcaccaaatgcacgtgtccctg
gccatgccggtgtcagcgctttctggcgcgttggaccgttttgacgagtttggtttgctc
caggcagtgaccgagcttgacgtgaccacagggacccctgtgacggacgcgaagttggtg
gagcaagggtactactaccgtgacaccttcaccatgatccgtgagttcgctgcggagact
ggccgtttgtggtcggcaaccgtgtggggtctgaccgatggccgttcctggcgtgtggac
gatggtgctccgattctctttgatgacgactaccaggcgaagcaggcgttctacggggca
atcgactccgatgaacttgacccgatcatccgtaccgcgaatgtgttccaaccctcgatt
gacgatgtgtcagtgacgtcagcagagtgggaccggttgcccatgcacgacgttgaggat
gcagggttcttccaactgcggtggggttcggatgcgctgactgctcttgtgtatgtggat
gaccctgacgctggtgcaggtgaccgggtggagttcacccttgatggtgacacatggtcg
gtcaaccgtgacagtgactcggttgttgagtttgacgggtacggctgggcctttaccact
cagttcgatgttgcgggcgcggcagctggtgacactcacgatttcgatgttcggttggtg
aatgacggtgacacggtggggtggaacagcccaggtgccaccggtattctcaccctcatt
gaacagttgtcgtacaccactgcgattgaggcggacactgcaccacagattgatggtgtg
atggacgatgtgttcgctgacgcacagtcgatcacgacgggtaagcaggtcagcggcact
gatggtgccactgcggacactcgtgcggtgtggaacgggtccacgttgtatttgttcgct
gagatcactgaccctgacgtggacgtcacctccgcatctccgtgggagcaagactcagtg
gagatttacgtggacatggggaacgcaaagaatggttcctaccgtgatctcgacacccag
atccgtatttcggcgcagaatgttgtgtcgttcggtactggtgacgaggccatgcaggaa
gcacgcatcacctcggctaccgctgccacagacacagggtacatcgttgaggtggccatt
gatttgggtgacgagggtggtgcgggcacgttccagggcttcgatttccaggtcaatgat
gcgtcagatggtgctcgcgcatccatcacgaactgggctgacccaacgggtgcaggctac
caatccacggcgcgttggggtgtgattgaactccttgccgctgatgaagatggtgaccct
gttgttcctggtgagccgaaccttccaggttctggcgggtcgggctctgatggggcagga
tctgattctgactctggttctgatgatggtgctgctgggtcggacactgaggacggtgac
agtgatggtttagctgacactggtgcgaacccgttgcccattattctcggtgcgattctt
ctggcacttgctggtggagcgatcgtggtattgcgtcgccgtctggtgggcgcgcaggac
agcgatgagttgaccgtgtga

DBGET integrated database retrieval system