KEGG   Jonesia denitrificans: Jden_1729Help
Entry
Jden_1729         CDS       T00972                                 

Definition
1,4-alpha-glucan-branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
jde  Jonesia denitrificans
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:jde00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Jden_1729
Enzymes [BR:jde01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Jden_1729
Exosome [BR:jde04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Jden_1729
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1878520..1880745
Genome map
AA seq 741 aa AA seqDB search
MALTQNTPPAPLPISSELLTAIAHGTHHDPHTVLGPHVHPPLKATGPQWATVRVSRPLAT
SVSLITATDRHTMTHEHEGVWVAVIPAPGGNAPEYQVDTTWGDTTHTSDDGYRFLPTISE
FDLHLIGEGRHEQLWTALGANQRNYPTSFGTTTGTAMAVWAPTARAVRVIGDFNGWDGRA
HAMRSLGSSGIWELYLPGVGPGAPYKFEIYTADGQWLRKADPLARATEVPPATASIVADD
TYTWGDNTWMTRRATRDPHDQPMSIYEVHLGSWRQGLNYRDAAHQLTEYISDMGFTHVEF
LPLAEHPFGGSWGYQVTSYYAPTSRFGNPADFKYLVDTLHQAGIGVILDWVPAHFPKDEW
ALGRFDGTCLYEHPDPHQGEHPDWGTYIFNYGRNEVRNFLVANATYWLEEFHIDALRVDA
VASMLYLDYSRVDGQWTPNRHGGRENLDAIAFLQEANATAYRRNPGTMMIAEESTAFPQV
TAPTHVGGLGFGFKWNMGWMNDTLRYLHEEPVNRRWHHGMLTHTISYAFSEQFLLPLSHD
EVVHGKGSLFTKMPGDDWQRFASVRSLFAWQWAYPGKQLLFMGNEFAQRGEWREGGSLEW
GSLNDPAHARVRGLVRDLNTLYQRHRALWDNDHSPEGFRWLEYRDSDHNTVSFTRTSHNG
DQVVVIANFAGVPHENYRVPLPHGGTWREELNTDSSVYGGSGVSNTSPIAADNTPWGDGA
SHSAVIRVPPLGVLYLVPESH
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
atggcgctaacccagaacaccccacctgcaccgttacccatcagcagtgaactactcacc
gcaatcgcacacggcacccaccacgacccacacacagtacttggcccccatgtccacccc
ccgctcaaagcgactggaccccaatgggcgaccgttcgtgtctcccgccccctggcaacc
agcgtcagcctcatcaccgcgaccgaccgtcacaccatgacccacgaacacgaaggggtg
tgggtcgccgtcatccccgcgccaggtggcaacgcccccgaataccaggttgacaccacc
tggggtgacaccacgcacaccagcgacgatggataccggttcctacccaccatcagcgaa
tttgacctccacctcattggcgaaggtcgacacgagcagttgtggaccgcactcggcgcg
aaccaacgcaactaccccacatcgtttggcaccaccaccggaacagccatggcggtgtgg
gctcccaccgcccgcgccgtgcgtgttattggtgacttcaacgggtgggacgggcgcgcc
cacgcgatgcgcagcctcggctcctccggaatctgggaactctacctccccggtgtcggc
cccggtgcgccctacaagttcgagatttacactgcggatgggcaatggctccgcaaagct
gaccccctggcccgcgccacagaagttcccccagccacagcaagtatcgtcgctgacgac
acctacacctggggtgacaacacctggatgacacgccgcgccacccgcgatccccacgac
caacccatgtcgatctacgaggtgcacctgggttcatggcgacaaggactcaactaccgc
gacgccgcacaccaactcaccgaatacatcagcgacatggggttcacccacgtcgagttc
ctcccactagccgaacaccccttcggtggttcatggggctaccaagtcacctcttactac
gcacccacctcccggtttgggaacccagccgacttcaaatacctcgtcgacacccttcac
caagcaggaatcggcgtcatccttgactgggtgcccgcccacttccccaaagacgaatgg
gcacttggccgattcgatggcacctgtttgtacgaacacccagacccccaccaaggtgaa
caccctgactggggaacctacattttcaactacggtcgcaacgaagtgcgcaacttcctc
gttgccaacgcaacctactggctggaagagttccacattgatgctctccgcgtcgacgcg
gtcgcctccatgctctatctcgactactcacgcgttgacggccaatggacccccaaccgt
cacggaggacgcgaaaacctcgacgcaattgctttcctgcaagaagccaacgccaccgct
taccggcgaaaccctggcaccatgatgatcgccgaagaatcgacggcattcccccaagtc
accgcccccacccacgttggtggactcggcttcgggttcaaatggaacatgggctggatg
aacgacaccctgcgctatctccacgaagaacccgtgaaccggcggtggcaccatggaatg
ctcacccacactatttcctacgcgttctccgaacagttcctcctccccttgtcccacgac
gaagtcgtccacggaaaagggtcactcttcacaaaaatgcctggcgacgactggcaacgg
ttcgccagcgtccgctcactgttcgcctggcaatgggcgtaccccggcaaacaactcctc
ttcatgggcaacgagttcgcccagcgtggcgaatggcgtgaaggcgggtccctggaatgg
ggatcactcaatgacccggcccacgcacgtgtccgcgggctggtgcgcgacctcaatacc
ctctaccagaggcaccgcgcactgtgggacaacgatcactcccccgaaggattccggtgg
ctcgaatatcgcgactccgaccacaacacggtgagtttcacccgcacctcccacaacggt
gaccaggtcgtcgtcatcgcgaacttcgcgggagtcccccatgaaaactaccgggtcccc
ctcccccacggcggcacctggcgtgaagaactcaacactgactccagcgtgtacggcggg
tccggggtgagtaacacatcgcctatagcagcagacaacaccccttggggggatggtgca
tcccactcagcagtgattcgcgtcccaccattaggcgtcctctacctcgtcccagagtcg
cactaa

DBGET integrated database retrieval system