KEGG   Jonesia denitrificans: Jden_1789Help
Entry
Jden_1789         CDS       T00972                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
jde  Jonesia denitrificans
Pathway
jde00260  Glycine, serine and threonine metabolism
jde00750  Vitamin B6 metabolism
jde01100  Metabolic pathways
jde01110  Biosynthesis of secondary metabolites
jde01120  Microbial metabolism in diverse environments
jde01230  Biosynthesis of amino acids
Module
jde_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:jde00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Jden_1789
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Jden_1789
Enzymes [BR:jde01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Jden_1789
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP PK_C
Motif
Other DBs
NCBI-ProteinID: ACV09432
UniProt: C7QZD4
Position
complement(1951913..1952983)
Genome map
AA seq 356 aa AA seqDB search
MAHVWQGIIKEYADYLPEHLTTHIVTLGEGGTPLVPAPALSQATGATVYLKVEGMNPTGS
FKDRGMTTAISAAAARGAKAVVCASTGNTSASAAAYATHAGMVCAVLVPDGKIAMGKLSQ
AIAHGAQLLQVDGNFDDCLVAARKLAEAYPVELVNSVNPDRIEGQKTGSFEVVDVLGDAP
DIHALPVGNAGNITAYWKGYQEYYDAGQATKTPAMWGFQAEGASPIVAGHPFDEPETIAT
AIRIGNPASWDKALAARDTSGGLIDSVTDHEILAAHRLLSADVGVFVEPASAAGAAGILK
HAAAGRVPHGATIVITVTGHGLKDPAWALRTESGEDITPVRVTADVVSIAQALGLN
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atggcccacgtgtggcaaggcatcatcaaagaatatgccgactacctgccagaacacctc
accacccacattgtgacactcggtgaagggggcaccccactcgttccggccccagcactg
tcccaggcaaccggtgcaacggtctacctcaaagttgaaggcatgaaccccaccggttcc
ttcaaagaccggggcatgaccaccgcaatttcggctgctgctgctcggggagccaaagca
gtagtgtgcgcatcgaccggtaacacctccgcgtccgccgccgcctacgccactcacgct
ggaatggtctgtgctgtcctggtcccggatgggaagattgccatggggaagctctcacaa
gccattgcccacggtgcacaactcctccaagtcgacggaaactttgacgattgccttgtc
gcggcccggaaacttgctgaagcctacccggttgagctcgtgaactcggtcaaccctgac
cgtattgaaggacaaaaaaccgggtcatttgaggttgttgacgtccttggtgacgccccc
gatattcacgctctgccggtaggaaacgcagggaacatcactgcgtactggaaggggtac
caggaatactacgacgctggtcaggccacaaaaacccccgccatgtggggttttcaagcc
gaaggtgcatccccgatcgttgctggacacccgtttgacgaaccagaaactattgccacc
gctatccgcattgggaaccccgcgtcctgggacaaagctctggcagcacgagacacctca
ggcggtctcattgactccgtcacagaccacgaaatccttgccgctcaccggttgctgtcc
gccgatgttggcgtgtttgttgagccagcctcggccgctggagctgcggggatcctcaag
cacgctgccgctggccgcgtgccccacggagccaccattgttattaccgtcaccggccat
ggtttgaaagatccggcgtgggcgcttcgcacagaatctggcgaggacatcactcccgtg
cgagtcaccgctgatgtggtgtccattgcgcaggctctgggactgaactga

DBGET integrated database retrieval system