KEGG   Jonesia denitrificans: Jden_1789Help
Entry
Jden_1789         CDS       T00972                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
jde  Jonesia denitrificans
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:jde00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Jden_1789
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Jden_1789
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Jden_1789
Enzymes [BR:jde01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Jden_1789
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1951913..1952983)
Genome map
AA seq 356 aa AA seqDB search
MAHVWQGIIKEYADYLPEHLTTHIVTLGEGGTPLVPAPALSQATGATVYLKVEGMNPTGS
FKDRGMTTAISAAAARGAKAVVCASTGNTSASAAAYATHAGMVCAVLVPDGKIAMGKLSQ
AIAHGAQLLQVDGNFDDCLVAARKLAEAYPVELVNSVNPDRIEGQKTGSFEVVDVLGDAP
DIHALPVGNAGNITAYWKGYQEYYDAGQATKTPAMWGFQAEGASPIVAGHPFDEPETIAT
AIRIGNPASWDKALAARDTSGGLIDSVTDHEILAAHRLLSADVGVFVEPASAAGAAGILK
HAAAGRVPHGATIVITVTGHGLKDPAWALRTESGEDITPVRVTADVVSIAQALGLN
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atggcccacgtgtggcaaggcatcatcaaagaatatgccgactacctgccagaacacctc
accacccacattgtgacactcggtgaagggggcaccccactcgttccggccccagcactg
tcccaggcaaccggtgcaacggtctacctcaaagttgaaggcatgaaccccaccggttcc
ttcaaagaccggggcatgaccaccgcaatttcggctgctgctgctcggggagccaaagca
gtagtgtgcgcatcgaccggtaacacctccgcgtccgccgccgcctacgccactcacgct
ggaatggtctgtgctgtcctggtcccggatgggaagattgccatggggaagctctcacaa
gccattgcccacggtgcacaactcctccaagtcgacggaaactttgacgattgccttgtc
gcggcccggaaacttgctgaagcctacccggttgagctcgtgaactcggtcaaccctgac
cgtattgaaggacaaaaaaccgggtcatttgaggttgttgacgtccttggtgacgccccc
gatattcacgctctgccggtaggaaacgcagggaacatcactgcgtactggaaggggtac
caggaatactacgacgctggtcaggccacaaaaacccccgccatgtggggttttcaagcc
gaaggtgcatccccgatcgttgctggacacccgtttgacgaaccagaaactattgccacc
gctatccgcattgggaaccccgcgtcctgggacaaagctctggcagcacgagacacctca
ggcggtctcattgactccgtcacagaccacgaaatccttgccgctcaccggttgctgtcc
gccgatgttggcgtgtttgttgagccagcctcggccgctggagctgcggggatcctcaag
cacgctgccgctggccgcgtgccccacggagccaccattgttattaccgtcaccggccat
ggtttgaaagatccggcgtgggcgcttcgcacagaatctggcgaggacatcactcccgtg
cgagtcaccgctgatgtggtgtccattgcgcaggctctgggactgaactga

DBGET integrated database retrieval system