KEGG   Jonesia denitrificans: Jden_1798Help
Entry
Jden_1798         CDS       T00972                                 

Definition
iron-containing alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
jde  Jonesia denitrificans
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:jde00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Jden_1798
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Jden_1798
   00620 Pyruvate metabolism
    Jden_1798
   00650 Butanoate metabolism
    Jden_1798
  Lipid metabolism
   00071 Fatty acid degradation
    Jden_1798
  Amino acid metabolism
   00350 Tyrosine metabolism
    Jden_1798
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Jden_1798
   00626 Naphthalene degradation
    Jden_1798
Enzymes [BR:jde01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Jden_1798
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Jden_1798
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1962269..1965031
Genome map
AA seq 920 aa AA seqDB search
MTATENAVATPAQQEVDALVTKAQGALKEFLALDQEAVDYIVKKASVAALSVHGELAVSA
VKETGRGVFEDKAVKNIFACEHVTNSMLSLRTAGVISHDELTGITEIAEPVGVICGVTPV
TNPTSTAIFKALISLKTRNPIVFGFHPSAQNCSVEAAKVVRDAAVAAGAPEDCIQWVEHP
SLEATSALMNHPGVALILATGGNAMVRAAYSCGKPALGVGAGNVPAFIERTARLKRAVND
VVLSKAFDNGMICASEQAVILDEPIYDEAMAEFRKLHAHVATPAEKKMLEEFIFGVNANS
ENCGEAKLNATVVGKSPVWIAEQAGFEVPEDTSIILAEISEVGPSEPLSREKLSPVLAVL
RAKDAEEGIRLSEQMVEFDGLGHSGAIHSDDQDIIREFGKRVKAVRIITNAPSALGGIGD
IYNAFIPSLTLGCGSYGHNSVSNNVSAVNLVNVKRIGRRNNNLQWFKVPAKTYFEPNAIR
YLADMRGINRVTIVTDPTMTKLGFVDRILDVLHRRPGNRIALQIIDNVMPEPTVKFVQEG
AAQMRHFQPDTIIALGGGSPMDAAKVMWLLYEHPDIEFSDMKEKFFDVRKRAFKFPDLGA
LAKLVCIPTTSGTGSEMTPFAVISDPEKNKKYPLADYALTPTVAIVDPVLTEMMPDFLAA
DTGFDALTHATEAYVSVYANDYTDGLALHAIKLIFDNIVLSVKGGPGSKDEKVVKAREKM
HNAGAIAGMAFGNAFLGIVHAMSHVTGSTFKLVHGRTNATYLPHVIRYNGTVPTKLNAWP
KYEHYVAPERFQQIAAHLGLPASTPEEGVESYARAIEELREAVGIPASFQLQGVNEEAFI
GRLDEVAMGAYEDQCAPANPRMPMIEDMKTIMEAAYYGTSFDEVRARRKAARAAEVAVAK
EETGDVAAPVDEPKARGKRK
NT seq 2763 nt NT seq  +upstreamnt  +downstreamnt
atgactgccacagaaaatgccgtcgccactcctgcacaacaggaagtcgatgcgctcgtc
accaaagctcagggtgcactcaaggaattccttgcactcgaccaagaagccgttgactac
attgtcaagaaagcatccgttgccgcgttgagcgtccacggtgaactcgccgtctccgct
gtgaaagaaaccggccgcggcgtcttcgaagacaaagcagtgaagaacatcttcgcctgc
gaacacgtcaccaactccatgctgtccctacgcacagcaggtgtaatcagccacgacgaa
ctgaccggaatcaccgagatcgctgaaccagttggcgtgatctgtggcgtgactcccgtc
acgaaccccacctccacggccatcttcaaagctcttatctcactgaagacccgtaacccc
atcgttttcgggttccacccctccgcacaaaactgctccgttgaagccgctaaggttgtc
cgcgacgcagctgtcgccgcgggggcacctgaagactgcatccaatgggttgaacaccca
tcactggaagcaaccagtgccctcatgaaccacccaggtgtggcactcatcctcgccacc
ggtggaaacgccatggtacgcgcagcgtactcctgcggaaaaccagccctcggtgttggc
gccggaaacgtccccgccttcatcgaacgcaccgcacgcctcaagcgcgctgtcaacgac
gttgtcttgtctaaggcattcgacaacgggatgatctgcgcatcagaacaggccgtcatc
cttgacgaacccatctatgacgaagcaatggctgagttccgtaagctccacgctcacgta
gccacaccagcagaaaagaagatgcttgaagagttcatcttcggtgtcaacgcgaacagc
gagaactgcggagaagccaagctcaacgcaacagtcgtgggtaagtctcccgtatggatc
gcagagcaggctggcttcgaagttcctgaagacacctcaatcatccttgctgaaatctcc
gaagttggcccctcagagccactgtcccgcgaaaagctcagccccgtgcttgccgttctt
cgtgccaaggacgctgaagagggtattcgcctctctgagcaaatggtggaatttgacggt
ctgggccactccggtgcaatccactccgatgaccaagacatcatccgggagttcggcaag
cgggttaaagctgttcgtatcatcaccaacgccccctccgcactgggtggtatcggtgac
atctacaacgctttcatcccctccctcaccctgggctgtggctcctacggacacaactca
gtttccaacaacgtgtcggcggtaaacctcgtgaacgtcaagcgcatcggacgcaggaac
aacaacctccagtggttcaaggttccagcaaaaacctacttcgagcccaacgcgatccgc
tacctcgctgacatgcgtggcatcaaccgcgtcaccatcgtcaccgaccccaccatgacc
aagctcggctttgtggaccgcatcctcgatgttcttcaccgccgccccggtaaccggatt
gcgttgcaaatcattgacaacgtcatgccagagccaacagtgaagttcgttcaggaaggt
gccgcgcaaatgcgtcacttccagcctgacacgatcatcgcacttggtggtggctccccg
atggacgctgccaaggtgatgtggctgctctacgaacacccagacatcgagttctccgac
atgaaggagaagttcttcgacgtccgtaagcgtgccttcaagttccctgaccttggcgct
ttggccaagttggtctgcatccccaccacgtcaggaactggttcggaaatgacaccgttc
gcggtgatctctgatccagagaagaacaagaagtacccacttgctgactacgcgctgaca
cccaccgtggcgattgtggaccccgtactcaccgaaatgatgccggacttcctcgccgca
gacaccggtttcgacgctctgacccacgcaaccgaggcgtatgtgtcggtgtacgccaat
gactacaccgatggtcttgcactccacgcgatcaagttgatcttcgacaacatcgtgttg
tcggtcaagggtggcccagggtcaaaggacgagaaggtcgtcaaggctcgggagaagatg
cacaacgccggtgcgatcgccggtatggcgttcggtaacgcgttccttggcatagtccac
gccatgtcccacgtgaccggttcgaccttcaaactagttcacggtcggacaaacgccacc
tacctgccgcacgtgatccgctacaacggaactgttcccaccaagctcaacgcctggcca
aagtacgagcactacgttgctccagaacggttccagcagatcgctgctcacctcggactt
cctgcgtcaacgccggaggagggtgtggaatcctacgcacgcgccatcgaagaactgcgt
gaagctgtcggaattcctgcatcattccaactgcaaggcgtgaacgaggaagccttcatc
ggtcgcctcgacgaggttgcaatgggcgcatacgaagaccagtgcgcaccagcaaaccca
cgcatgccgatgatcgaggacatgaagaccatcatggaagctgcgtactacggcaccagc
ttcgatgaggtgcgggcgcgccggaaggctgcacgtgcagctgaggtggccgtagccaag
gaggaaaccggggacgtggcagctccggtcgacgaaccaaaggctcgcggtaagcgcaag
taa

DBGET integrated database retrieval system