KEGG   Jonesia denitrificans: Jden_1959Help
Entry
Jden_1959         CDS       T00972                                 

Definition
isochorismatase hydrolase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
jde  Jonesia denitrificans
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:jde00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2151071..2151655
Genome map
AA seq 194 aa AA seqDB search
MADELRRALLVVDVQPTFCEGGALGVVGGNAVAHRIADFVTQHRDEYALVATTQDWHIDP
GEHFSDTPDFVDSWPPHGVAGTAEAELHPALASLAPTVSVKKGQYAAAYSGFEGTTPDGV
SLRDALTEHGITHVDVVGIAESHCVKATAIDAHDAGFTTRVFTDLTVPVTEDQGVAARVT
MSEHGVELVQATPV
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggctgatgaactgcgtcgcgctttgcttgttgttgatgtgcaacccactttttgtgaa
ggtggggcgctgggtgttgttgggggcaacgcggttgcccaccgcatcgctgattttgtt
acccaacaccgcgatgagtacgccctggtggcaaccacccaagattggcacattgaccca
ggtgaacacttctctgacaccccagattttgttgactcctggccaccgcacggggtcgcc
gggaccgctgaagccgagttacacccagcattggcgtccctggcacccacggtcagtgtg
aagaagggacagtatgcggccgcctactcgggatttgagggcaccacaccagacggtgtc
tcccttcgcgacgccctgacagaacatggcatcacacacgttgatgttgtcggaatcgcc
gaatcacactgtgtgaaagcaaccgccattgacgcacatgacgcaggattcactacccgc
gtttttactgacctgacagttccggtcaccgaagatcaaggcgtcgcggcgcgcgtaacc
atgtcagaacacggtgtggaacttgttcaggccacgccagtgtga

DBGET integrated database retrieval system