KEGG   Jonesia denitrificans: Jden_2086Help
Entry
Jden_2086         CDS       T00972                                 

Definition
(RefSeq) phosphoglycerate mutase (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
jde  Jonesia denitrificans
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:jde00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Jden_2086
   01230 Biosynthesis of amino acids
    Jden_2086
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Jden_2086
  Energy metabolism
   00680 Methane metabolism
    Jden_2086
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Jden_2086
Enzymes [BR:jde01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Jden_2086
Exosome [BR:jde04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Jden_2086
  Exosomal proteins of melanoma cells
   Jden_2086
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2277977..2278723)
Genome map
AA seq 248 aa AA seqDB search
MTYTLVLLRHGESEWNAKNLFTGWVDVQLSDKGREEARRGGEMLKEADLLPDVVHTSLLL
RAITTANLALEAAGRHWIPVKRNWRLNERHYGALQGKDKAQTLAEYGEEQFMLWRRSYDT
PPPAIDAGSEFSQDADPRYATDGASDVRTECLKDVLEREIPYWENDIKADLKDGKTVLVA
AHGNSLRALVKLLDGISDEDIAGLNIPTGMPLVYELDENFVPVTKGGRYLDPEAAAEAAA
AVAAQGKK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgacatacaccctcgtactactccgtcacggcgagagcgaatggaacgcgaagaacctc
ttcactggctgggttgatgtccagctttccgacaagggccgcgaggaagcgcgtcgcggc
ggcgagatgctgaaagaagcagatctcctccccgacgttgtgcacacctcattgttgctt
cgcgcgatcaccaccgcgaaccttgccttggaggctgcaggccgccactggatcccagtg
aaacggaactggcgcctcaatgaacgccactacggtgcgttgcaaggaaaggacaaggca
caaactcttgccgagtacggtgaagagcagttcatgttgtggcgtcgttcctacgacacg
ccgccacctgccatcgacgctggctcagagttctcgcaagatgcggacccacggtacgca
actgacggtgcaagcgacgtgcgcaccgagtgcctcaaagacgttctggaacgcgaaatc
ccttactgggaaaacgacatcaaagcggacctcaaggacggcaagactgttcttgtggca
gcacacggaaactctctgcgtgcgcttgtcaaactgcttgatggcatctctgatgaagac
attgctgggctcaacattcctacgggcatgccgttggtatacgaactggacgagaacttt
gttcccgtgaccaagggcggccgttacctcgacccagaagctgcagcagaagctgcagcg
gcagttgctgctcagggcaagaagtaa

DBGET integrated database retrieval system