KEGG   Jonesia denitrificans: Jden_2199Help
Entry
Jden_2199         CDS       T00972                                 

Definition
(GenBank) Uroporphyrinogen III synthase HEM4
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
jde  Jonesia denitrificans
Pathway
jde00860  Porphyrin and chlorophyll metabolism
jde01100  Metabolic pathways
jde01110  Biosynthesis of secondary metabolites
jde01120  Microbial metabolism in diverse environments
Module
jde_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:jde00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Jden_2199
Enzymes [BR:jde01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Jden_2199
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 Trans_reg_C
Motif
Other DBs
NCBI-ProteinID: ACV09836
UniProt: C7R1K1
Position
complement(2374359..2375477)
Genome map
AA seq 372 aa AA seqDB search
MTSTPLAGYRIAVTSDRRSADLIDAFERRGAHVIHAPLLKIAPKEHDEELINETRRIINQ
APDILIVTTAYGFRRWIETADAAGLGDELERVLNATRIYVRGPKARGAVRALGFDDCGVS
PDERLITLATQLAEHPLTGTRIAVQLHGHDDLTALARLTLAGADVTTVTPYRWTPATDTG
DKREQLLTALLNGSIDVLTFTAAPVVDAFFSYVAEQSCTSHILHQLRTVTTVATVGPVTA
APLIAHGITPLIPDRFRMGAMIKLIVDHMTTDARTTIPTPHGHLTLQGNRLTLTTTDNTT
CVTLTDSQRVVMRALTHTPGNVVTRAHLGTLLGVGHTDHALDVAISRLRTALPDSRLIST
VIKRGYRLNVSH
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
gtgaccagcacaccactggccggataccgcatcgccgtcacctccgaccggcgctcagca
gacctcatcgacgccttcgaacggcgcggcgcccacgtcatccacgcaccactgctgaaa
atcgcacccaaagaacacgacgaagaactcatcaacgaaacccgccgcatcatcaatcag
gcaccagacatcctcatcgtcaccaccgcctacggatttcgccgatggatcgaaaccgcc
gacgccgccggactcggtgacgagctcgaacgcgtcctcaacgccacccgcatctacgtg
cgcggccccaaagcgcgcggagccgtgcgcgccctcggattcgacgactgcggcgtctca
cccgatgaacgcctcatcactctcgccacccaactggccgaacaccccctcaccggcacc
cgcatcgccgtccaactccacggacacgacgacctcacagccctcgcccgactcaccctc
gccggagctgacgtcaccacagtcaccccctaccggtggacaccagccaccgacaccggc
gacaaacgcgaacaactcctcaccgcgctcctcaacggttccattgacgtcctcaccttc
accgcggcccccgtcgtcgacgcattcttctcctacgtcgccgaacaatcctgcacctcc
cacatcctccaccaactacgcaccgtcaccacagtggccaccgtcggccccgtgaccgca
gccccactgatcgcccacggcatcacccccctcatccccgaccgattccgcatgggcgcc
atgatcaaactcatcgtcgaccacatgaccaccgacgcccgcaccaccatccccacaccc
cacgggcacctcaccctccaaggcaaccgcctcacactgaccaccacagacaacaccaca
tgtgtgaccctcactgactcccaacgcgtggtcatgcgtgccctcacccacaccccaggg
aacgtggtcacccgagcacacctcggcactctcctcggcgttgggcacaccgaccacgcc
ctcgacgttgcgatctcacgcctgcgcaccgccctcccggactcacggctcatctccacc
gtcatcaaacgcggctaccgactcaacgtgtcccactag

DBGET integrated database retrieval system