KEGG   Jonesia denitrificans: Jden_2230Help
Entry
Jden_2230         CDS       T00972                                 

Definition
acetate/CoA ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
jde  Jonesia denitrificans
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:jde00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Jden_2230
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Jden_2230
   00620 Pyruvate metabolism
    Jden_2230
   00640 Propanoate metabolism
    Jden_2230
  Energy metabolism
   00680 Methane metabolism
    Jden_2230
Enzymes [BR:jde01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Jden_2230
Lipid biosynthesis proteins [BR:jde01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Jden_2230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2417473..2419515
Genome map
AA seq 680 aa AA seqDB search
MMMQPEVLVPEHTQPATLDNLLQETRTFPPPAQFAAQANATAVLYDQAASDREGFWADQA
RTHVTWKTPFSTTLDWSDAPVAKWFADGTLNAAYNAVDRHVLAGNGDRVAFFFEGEPGDT
RTITYNDLQRETSRAANALAALGVTRGDRVVIYLPLIPEAVIAMLACARVGAIHSVVFGG
FSAEALRSRIADAQATVVITADGGFRRGSASALKPAVDEALSGHGSSVEHVLVVRRTGQD
TTMVEHRDLWWHDALADANTAHEPAWVDAEHPLFILYTSGTTGAPKGIVHTTGGYLTQTA
FTHHHVFDLKPEQDVYWCTADIGWVTGHSYVVYGPLVNGATQVLYEGTPDTPHQGRWWEI
VEKYGVSILYTAPTAIRTFMKWGEDIPSSYNLSSLRVLGSVGESINPEAWMWYRRVIGGD
QAPIVDTWWQTETGAIMISPLPGVTAAKPGSAQIPLPGIRADVVNDFGEPVGPGAGGYLV
LSEPWPAMLRGIWGDRQRFVDTYWSRFSGIYFAGDGAKRDDDGDIWLLGRVDDVMNISGH
RLSTMEIESALVSHPDVAEAAVVGASDDTTGQAVVAFVILRGHATERIGEQGHEEVVAAL
RAHVAKEIGPIAKPRDILVVPELPKTRSGKIMRRLLRDVAEHRVVGDATTLADSSVMDLI
SAKLAMPGSRAPSTTKERSR
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
atgatgatgcaaccggaggttctcgtgcccgaacatacccagcccgcgacgctggacaac
ctgctccaagaaacccgaacgtttcccccgccggcccagtttgctgctcaagcgaatgcc
accgctgtcctctacgatcaagccgccagcgaccgggaggggttttgggcggaccaagcc
cgcacacacgtgacctggaaaactccgttttccacaacgttggattggtcggatgcaccg
gttgccaagtggtttgctgacggcaccctcaacgccgcatataacgcagtggatcggcat
gttcttgccggcaacggggaccgggtggcgttcttcttcgaaggggagcccggcgacacc
cgcaccatcacttacaacgacctgcagcgcgaaacatctcgggcggcaaatgcgctggct
gcgttaggtgtcacacgtggggaccgggtggtgatctacctccctttgatcccggaggct
gtcattgccatgctcgcctgcgcgcgggtgggcgcaatccattcggtggtgttcggcggc
ttttccgcagaagcacttcgttctcgtattgccgatgcgcaagccaccgtggtcattact
gctgacggtgggttccggcggggttccgcctccgcgttaaagcctgccgttgatgaagcg
ttgagtgggcatgggtcaagcgttgagcatgttcttgtggtgcgccgcactgggcaggac
acaaccatggttgagcaccgtgacctgtggtggcacgatgcgttggcggatgctaacacg
gcgcatgagccggcatgggttgacgcggagcacccgttgttcattttgtatacctcgggg
acaacgggcgcacccaagggtattgtccacaccacgggtggttatctcacccaaaccgcg
tttactcaccaccatgtgtttgatctcaaaccagagcaggacgtgtactggtgtaccgct
gatattgggtgggttacaggtcattcttatgttgtgtatggtccgctggtcaacggggcc
acccaggtgctgtatgaagggacacctgacactcctcaccaaggtcgttggtgggagatc
gtggaaaagtatggggtgtcaatcctgtacaccgccccgacagcgattcgaacattcatg
aagtggggcgaagacattccttcgtcgtacaacctgagttccttacgggtgctgggatct
gtgggggagtcgattaaccctgaagcgtggatgtggtaccggcgggtcatcggcggggat
caggcacccattgtggacacgtggtggcaaacagaaaccggtgccatcatgatttccccg
ttgccgggggttactgccgcaaagcccggttcggcacaaatcccgttgcctgggatccga
gctgatgtggtcaacgactttggggaacccgtgggtcctggcgccggaggttatttggtg
ctgtctgaaccgtggcctgcgatgttgcgtggcatttggggtgaccggcaacgttttgtt
gacacgtactggtcccgcttttcaggcatctatttcgccggtgatggtgcaaaacgcgac
gacgatggtgacatctggttgttgggtcgggtcgatgacgtgatgaatatttctgggcac
cggctgtccacaatggaaattgagtcagcgctagtgtcgcaccccgacgtcgcggaagcg
gcggttgttggcgcatcggacgatacaacagggcaagctgttgttgcgttcgtgattttg
cgcgggcacgcaacagaacgcattggtgaacaaggacatgaggaggtggtggcagcgctc
cgggctcatgtggccaaggaaattggaccgatcgcaaaacctcgggacattcttgtggtt
ccggaacttcccaagactcgctctgggaaaattatgcgtcgcctactgcgggatgtggcc
gagcaccgggtggtgggagacgccacaacgctggctgattccagtgtgatggacctgatt
tcagccaaactcgccatgccggggtcacgtgccccctcaacaaccaaggaacggtcacgt
tag

DBGET integrated database retrieval system