KEGG   Jonesia denitrificans: Jden_2230Help
Entry
Jden_2230         CDS       T00972                                 

Definition
(GenBank) acetate/CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
jde  Jonesia denitrificans
Pathway
jde00010  Glycolysis / Gluconeogenesis
jde00620  Pyruvate metabolism
jde00640  Propanoate metabolism
jde00680  Methane metabolism
jde01100  Metabolic pathways
jde01110  Biosynthesis of secondary metabolites
jde01120  Microbial metabolism in diverse environments
jde01130  Biosynthesis of antibiotics
jde01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:jde00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Jden_2230
   00620 Pyruvate metabolism
    Jden_2230
   00640 Propanoate metabolism
    Jden_2230
  Energy metabolism
   00680 Methane metabolism
    Jden_2230
Enzymes [BR:jde01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Jden_2230
Lipid biosynthesis proteins [BR:jde01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Jden_2230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ACV09867
UniProt: C7R1N2
Position
2417473..2419515
Genome map
AA seq 680 aa AA seqDB search
MMMQPEVLVPEHTQPATLDNLLQETRTFPPPAQFAAQANATAVLYDQAASDREGFWADQA
RTHVTWKTPFSTTLDWSDAPVAKWFADGTLNAAYNAVDRHVLAGNGDRVAFFFEGEPGDT
RTITYNDLQRETSRAANALAALGVTRGDRVVIYLPLIPEAVIAMLACARVGAIHSVVFGG
FSAEALRSRIADAQATVVITADGGFRRGSASALKPAVDEALSGHGSSVEHVLVVRRTGQD
TTMVEHRDLWWHDALADANTAHEPAWVDAEHPLFILYTSGTTGAPKGIVHTTGGYLTQTA
FTHHHVFDLKPEQDVYWCTADIGWVTGHSYVVYGPLVNGATQVLYEGTPDTPHQGRWWEI
VEKYGVSILYTAPTAIRTFMKWGEDIPSSYNLSSLRVLGSVGESINPEAWMWYRRVIGGD
QAPIVDTWWQTETGAIMISPLPGVTAAKPGSAQIPLPGIRADVVNDFGEPVGPGAGGYLV
LSEPWPAMLRGIWGDRQRFVDTYWSRFSGIYFAGDGAKRDDDGDIWLLGRVDDVMNISGH
RLSTMEIESALVSHPDVAEAAVVGASDDTTGQAVVAFVILRGHATERIGEQGHEEVVAAL
RAHVAKEIGPIAKPRDILVVPELPKTRSGKIMRRLLRDVAEHRVVGDATTLADSSVMDLI
SAKLAMPGSRAPSTTKERSR
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
atgatgatgcaaccggaggttctcgtgcccgaacatacccagcccgcgacgctggacaac
ctgctccaagaaacccgaacgtttcccccgccggcccagtttgctgctcaagcgaatgcc
accgctgtcctctacgatcaagccgccagcgaccgggaggggttttgggcggaccaagcc
cgcacacacgtgacctggaaaactccgttttccacaacgttggattggtcggatgcaccg
gttgccaagtggtttgctgacggcaccctcaacgccgcatataacgcagtggatcggcat
gttcttgccggcaacggggaccgggtggcgttcttcttcgaaggggagcccggcgacacc
cgcaccatcacttacaacgacctgcagcgcgaaacatctcgggcggcaaatgcgctggct
gcgttaggtgtcacacgtggggaccgggtggtgatctacctccctttgatcccggaggct
gtcattgccatgctcgcctgcgcgcgggtgggcgcaatccattcggtggtgttcggcggc
ttttccgcagaagcacttcgttctcgtattgccgatgcgcaagccaccgtggtcattact
gctgacggtgggttccggcggggttccgcctccgcgttaaagcctgccgttgatgaagcg
ttgagtgggcatgggtcaagcgttgagcatgttcttgtggtgcgccgcactgggcaggac
acaaccatggttgagcaccgtgacctgtggtggcacgatgcgttggcggatgctaacacg
gcgcatgagccggcatgggttgacgcggagcacccgttgttcattttgtatacctcgggg
acaacgggcgcacccaagggtattgtccacaccacgggtggttatctcacccaaaccgcg
tttactcaccaccatgtgtttgatctcaaaccagagcaggacgtgtactggtgtaccgct
gatattgggtgggttacaggtcattcttatgttgtgtatggtccgctggtcaacggggcc
acccaggtgctgtatgaagggacacctgacactcctcaccaaggtcgttggtgggagatc
gtggaaaagtatggggtgtcaatcctgtacaccgccccgacagcgattcgaacattcatg
aagtggggcgaagacattccttcgtcgtacaacctgagttccttacgggtgctgggatct
gtgggggagtcgattaaccctgaagcgtggatgtggtaccggcgggtcatcggcggggat
caggcacccattgtggacacgtggtggcaaacagaaaccggtgccatcatgatttccccg
ttgccgggggttactgccgcaaagcccggttcggcacaaatcccgttgcctgggatccga
gctgatgtggtcaacgactttggggaacccgtgggtcctggcgccggaggttatttggtg
ctgtctgaaccgtggcctgcgatgttgcgtggcatttggggtgaccggcaacgttttgtt
gacacgtactggtcccgcttttcaggcatctatttcgccggtgatggtgcaaaacgcgac
gacgatggtgacatctggttgttgggtcgggtcgatgacgtgatgaatatttctgggcac
cggctgtccacaatggaaattgagtcagcgctagtgtcgcaccccgacgtcgcggaagcg
gcggttgttggcgcatcggacgatacaacagggcaagctgttgttgcgttcgtgattttg
cgcgggcacgcaacagaacgcattggtgaacaaggacatgaggaggtggtggcagcgctc
cgggctcatgtggccaaggaaattggaccgatcgcaaaacctcgggacattcttgtggtt
ccggaacttcccaagactcgctctgggaaaattatgcgtcgcctactgcgggatgtggcc
gagcaccgggtggtgggagacgccacaacgctggctgattccagtgtgatggacctgatt
tcagccaaactcgccatgccggggtcacgtgccccctcaacaaccaaggaacggtcacgt
tag

DBGET integrated database retrieval system