KEGG   Jonesia denitrificans: Jden_2478Help
Entry
Jden_2478         CDS       T00972                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
jde  Jonesia denitrificans
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:jde00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Jden_2478
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Jden_2478
Enzymes [BR:jde01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Jden_2478
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2661604..2662098
Genome map
AA seq 164 aa AA seqDB search
MDLTALNNTAITMIDGTATTLGQWGGQVRLIVNVASRCGLSPQYAQLEELQEYYGPKGFT
VLGCPSNQFLQELSSEEKIVDYCAENWGVTFPMTARLRVNGRSQHPLYELLTTIKDDNGK
AGRVKWNFEKFLIAPTGESYRFRPTVQPTDRVITSVIERHLPQQ
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atggatctcaccgcactgaataacacggctattaccatgattgatggcaccgccacgacc
ctgggacagtggggcggtcaggttcggctcatcgtcaatgtcgcctcgcgttgtggcctt
tccccacagtatgcgcagcttgaagagctccaggaatactacggccccaaagggttcact
gttcttgggtgtccctcaaaccagttcctccaagagttgtcctcggaggaaaagatcgtt
gactactgcgccgagaattggggtgtgactttccccatgactgcacgattgcgggttaat
gggcgcagccaacaccctctctacgaactgctcacaaccatcaaagacgacaatgggaag
gctgggcgcgtgaagtggaactttgagaagttcctcatcgcacccaccggtgagagttac
cggttccgccccactgtgcaacccacagaccgtgtcatcacatcagtcattgagcgtcac
cttccacagcagtga

DBGET integrated database retrieval system