KEGG   Jonesia denitrificans: Jden_2479Help
Entry
Jden_2479         CDS       T00972                                 

Definition
glycoside hydrolase clan GH-D
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
jde  Jonesia denitrificans
Pathway
Galactose metabolism
Glycerolipid metabolism
Brite
KEGG Orthology (KO) [BR:jde00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Jden_2479
  Lipid metabolism
   00561 Glycerolipid metabolism
    Jden_2479
   00600 Sphingolipid metabolism
    Jden_2479
Enzymes [BR:jde01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Jden_2479
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2662070..2664292)
Genome map
AA seq 740 aa AA seqDB search
MPETSQPNCHAMTCDHAPTQPVHLRAGGVSLVLDSPNAHLPRILYWGEELTGITDTSLAA
LATMTTPSATGGTIDTPAITSIITEPSSGWPGTPGLTGSRNGQAWTTAFRVTGYDLATTD
AGDLTTRWYATDTDAALTITLTITLLVTGIVRAHAAVTNAGDTPYQVDHLGVAFPFPAEA
TEALDFTGRWARERAPQRRPLTVGTHLREAVRGKPGHDAPYLTVVGEPHFGFRHGEVRAF
HLAWSGNQRIAIDTTFSGEQVVRAGEYLHPGEIQLAPGDTYTGPAVMAVWSGTGLDGVTQ
RFHQQMRARSRYPASPRPVTINVWEAVYFDHDAARLRDLAERAAALGVERYVLDDGWFGS
RRDDTSGLGDWQISHEVWPGDTLPQLAQYVHDLGMQFGIWFEPEMINPDSEVARRHPEWV
LAPTGRLPREARHQQVMDLTNPEAFAYVRDAMVEVIRRCNADYVKWDHNRDLLESGSQLT
GRAAVHEQTLAAYRLLDELRTQFPHLEIESCSGGGARIDWEILQRTDRVWASDCIDAHER
QMIQRWTSVVVPPEMMGSHVGDGRAHTTGRMHDIDYRAGTALFGHFGIEWDLARATDRDL
DSLRAWIARYKELRGLLHSGVTVRSDMDGAAHGTSACHVHGVVATDGTDAVFALVSTDRP
SSWPVRRVVLPGLDQQRTYTLDVLFAPTEINEQSHRQPGWWGQRLTVQGAVLSRVGLALP
DLNPDTLMLVRVTAVEGDAQ
NT seq 2223 nt NT seq  +upstreamnt  +downstreamnt
atgcccgagacctcacaacccaactgccacgccatgacgtgcgaccacgcaccaacacaa
cccgtccacctgcgagcaggcggtgtgtcacttgtccttgactcacccaacgcgcacctt
ccccgcatcctgtactggggtgaagaactcaccggaatcaccgacacgtcgctcgctgcc
ctcgccaccatgacaaccccctccgccaccggaggcaccattgacaccccagcgatcaca
tcgatcatcaccgaaccctcttccggatggccgggcaccccgggcctgaccggatcacgc
aacgggcaagcctggacaaccgcatttcgagtcaccgggtatgaccttgccaccacagac
gccggtgatctcactacccgctggtacgcaaccgacaccgatgccgccctcaccatcaca
ctcaccatcacgctgctggtcacgggtattgtccgggcgcacgcagcagtcaccaacgcc
ggcgacaccccctaccaagttgatcacctgggtgtagccttcccgttcccagccgaggcg
acagaggcgctcgactttactggacggtgggcgagggaacgcgccccacaacgccgcccc
ctcaccgtgggaacacacctgcgggaagccgtgcgcggcaaacccggccacgatgccccc
tacctcaccgtcgttggggaaccccactttgggttccggcacggtgaggtgcgcgcgttc
caccttgcctggagcgggaaccaacgcatcgcgatcgacacaacattttctggtgagcag
gttgttcgcgccggtgaatacttgcaccccggagaaattcaattagcaccaggcgacacc
tacacaggccctgcggtgatggctgtgtggtccgggaccgggttggacggagtgacccaa
cgcttccaccagcagatgcgcgcccgcagccggtaccctgcctccccccgacccgtgacc
atcaatgtgtgggaagcagtgtactttgaccatgatgcggcacggttgcgcgaccttgcg
gagcgcgctgccgcactgggggtggaacggtacgtccttgatgacggctggtttgggtca
cgccgagatgacacctcagggttgggtgactggcagatttcccacgaggtgtggcccggt
gacaccttgccgcaactagcgcagtacgtccacgatctggggatgcagttcgggatttgg
ttcgaaccggaaatgatcaaccccgattcggaggtggcccgccgccaccccgagtgggtt
ctcgcgccaactggtcgtcttccgcgtgaagcccgccaccagcaagtcatggacttaact
aaccccgaagcgttcgcctacgtgcgcgacgccatggtcgaggtgatccgtcggtgcaac
gccgattatgtgaagtgggatcacaaccgtgacctgctggaatcagggtcacaactgact
ggtcgggctgctgttcatgagcaaaccttggcggcctaccggctcttggatgagttgcgc
acacagttcccccacctggaaatcgaatcctgttctggcggtggggcgcgcatcgactgg
gagattttgcaacgcaccgaccgagtatgggcgtcggactgtattgatgcgcacgaacgt
cagatgatccaacggtggacgtccgtggtcgtccccccagagatgatgggctcccatgtg
ggagatgggcgggcacacaccaccgggcggatgcacgacattgactaccgtgcgggcaca
gcactgtttggacattttgggattgaatgggacttggctcgtgccacggaccgtgacctc
gactcgcttcgtgcctggattgcacggtacaaggaacttcgcggtttgttgcattcaggt
gtgaccgtgcggtcagacatggacggtgccgctcacggcaccagtgcgtgtcacgttcac
ggggtggtcgccacagacggtactgatgcggtattcgcgttggtatcgacagaccgcccc
tcatcgtggccggtgcggcgggtggtgctgcctgggcttgatcagcaacgcacctacact
ctcgacgtcctgttcgccccgacggaaatcaacgaacaatcacaccggcaacctggctgg
tgggggcagcgtctgaccgtgcagggggcagtgttgtctcgggtcgggttggcgctgcca
gacctgaacccagacaccctgatgttggtgcgggtcactgctgtggaaggtgacgctcaa
tga

DBGET integrated database retrieval system