KEGG   Jonesia denitrificans: Jden_2486Help
Entry
Jden_2486         CDS       T00972                                 

Definition
protoporphyrinogen oxidase (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
jde  Jonesia denitrificans
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:jde00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2669914..2671302
Genome map
AA seq 462 aa AA seqDB search
MTSVTIIGAGIAGLTAAHHLAVRGNKVTLVDASSQVGGFLAPLQMSGPHGDLLLDAGAES
FATRAPAVSALVTSLGLQVTSPEDRAGWCVPDRSSAFPLPSAGVLGIPVDPFAADARAAL
GWVGSVRAWVDRILPPRVGDTSNLDAFVRSRMGNKVADRLVSAIVGGVHSTSPTLLDVSA
IHPKFREYFADEGTLTGVVKRIRAAAPAGRAVSGIVGGLHTLPSTLYQSISAAGGTVLLD
EAVTALTQRDGRWVVQGTSGQDVSVSDHIIIALPARPALALLADTGIYDAGDQLNQVARG
TDIALATVVVHSKQLGSYPRGTGVLVSPDAGFQAKASTHANAKWGWVDEAVISAFGPDHH
VIRLSFGRHGDHLPTDDAAIVAHAATEVPALYGVSDCAVAASAVVRWPDALAPVTPTMRA
VASAAVAATTDSGLHIAGSWVAGTGLAATIPHAQGVAERIVN
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
gtgacctccgtaacgatcattggcgctggaattgctggtctcaccgctgcacatcacctt
gcggttcgcggcaacaaggtcacacttgtcgatgcgtcatcccaggtgggtggatttctt
gcgccgttgcagatgagcggacctcatggtgaccttcttctcgatgcgggggctgaatct
tttgctacccgagctcctgcggtctctgctctggtgacgtctctcggtttgcaggtgaca
agccctgaggatcgggctgggtggtgtgttccggatcgttcgtcagcgtttccgctgccc
tcagctggggtgttgggtatccccgtcgacccgtttgccgccgatgcccgcgcggccctg
gggtgggttggatcggttcgcgcctgggtggaccggatccttccgccgcgggtgggtgac
acctcgaacctggatgcttttgttcgttctcggatgggcaacaaggttgctgaccggctt
gtgtctgcaattgtgggaggtgtgcattccacgtcaccgaccctgttggatgtctccgcg
attcacccaaaatttcgggagtactttgccgatgagggcaccctgactggggtggtgaaa
cgcattcgtgcggcggctcctgctgggcgcgctgtcagtgggatcgtcggtgggttgcac
actctgccctccactctttatcagagtatttctgctgctggtggaactgttctcctcgat
gaagcggtgaccgcgttgacacagcgcgatgggcgctgggtggtgcaggggacgtcaggc
caggacgtgagcgtcagcgaccacatcatcattgcgttgcctgctcgaccggcactggcg
ttgctcgctgacacgggaatctatgacgctggtgatcagctaaaccaggtggcccgtggc
accgacattgcgctggccactgtggttgtgcactccaagcagctgggttcctaccctcgt
ggaactggtgtgcttgtgtcaccggacgctgggttccaagcgaaagcttccacgcatgct
aatgcaaagtgggggtgggttgatgaggctgtcatcagcgcttttggtcccgatcatcat
gtcattcggttgagttttgggcggcatggcgatcacctacccaccgatgacgccgccatt
gtggcacacgctgccactgaagttcctgcactgtatggggtcagtgactgcgccgttgcg
gccagcgccgtggtgcggtggccggacgccttggccccggtgactcccacgatgcgtgcg
gtggcctccgctgcggtggcagcaaccacagattcgggtcttcacattgccggctcgtgg
gtggctggcactgggctagcagcgacgattcctcatgcccagggggttgctgagcgtatt
gtgaactga

DBGET integrated database retrieval system