KEGG   Jonesia denitrificans: Jden_2486Help
Entry
Jden_2486         CDS       T00972                                 

Definition
protoporphyrinogen oxidase (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
jde  Jonesia denitrificans
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:jde00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Jden_2486
Enzymes [BR:jde01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Jden_2486
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2669914..2671302
Genome map
AA seq 462 aa AA seqDB search
MTSVTIIGAGIAGLTAAHHLAVRGNKVTLVDASSQVGGFLAPLQMSGPHGDLLLDAGAES
FATRAPAVSALVTSLGLQVTSPEDRAGWCVPDRSSAFPLPSAGVLGIPVDPFAADARAAL
GWVGSVRAWVDRILPPRVGDTSNLDAFVRSRMGNKVADRLVSAIVGGVHSTSPTLLDVSA
IHPKFREYFADEGTLTGVVKRIRAAAPAGRAVSGIVGGLHTLPSTLYQSISAAGGTVLLD
EAVTALTQRDGRWVVQGTSGQDVSVSDHIIIALPARPALALLADTGIYDAGDQLNQVARG
TDIALATVVVHSKQLGSYPRGTGVLVSPDAGFQAKASTHANAKWGWVDEAVISAFGPDHH
VIRLSFGRHGDHLPTDDAAIVAHAATEVPALYGVSDCAVAASAVVRWPDALAPVTPTMRA
VASAAVAATTDSGLHIAGSWVAGTGLAATIPHAQGVAERIVN
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
gtgacctccgtaacgatcattggcgctggaattgctggtctcaccgctgcacatcacctt
gcggttcgcggcaacaaggtcacacttgtcgatgcgtcatcccaggtgggtggatttctt
gcgccgttgcagatgagcggacctcatggtgaccttcttctcgatgcgggggctgaatct
tttgctacccgagctcctgcggtctctgctctggtgacgtctctcggtttgcaggtgaca
agccctgaggatcgggctgggtggtgtgttccggatcgttcgtcagcgtttccgctgccc
tcagctggggtgttgggtatccccgtcgacccgtttgccgccgatgcccgcgcggccctg
gggtgggttggatcggttcgcgcctgggtggaccggatccttccgccgcgggtgggtgac
acctcgaacctggatgcttttgttcgttctcggatgggcaacaaggttgctgaccggctt
gtgtctgcaattgtgggaggtgtgcattccacgtcaccgaccctgttggatgtctccgcg
attcacccaaaatttcgggagtactttgccgatgagggcaccctgactggggtggtgaaa
cgcattcgtgcggcggctcctgctgggcgcgctgtcagtgggatcgtcggtgggttgcac
actctgccctccactctttatcagagtatttctgctgctggtggaactgttctcctcgat
gaagcggtgaccgcgttgacacagcgcgatgggcgctgggtggtgcaggggacgtcaggc
caggacgtgagcgtcagcgaccacatcatcattgcgttgcctgctcgaccggcactggcg
ttgctcgctgacacgggaatctatgacgctggtgatcagctaaaccaggtggcccgtggc
accgacattgcgctggccactgtggttgtgcactccaagcagctgggttcctaccctcgt
ggaactggtgtgcttgtgtcaccggacgctgggttccaagcgaaagcttccacgcatgct
aatgcaaagtgggggtgggttgatgaggctgtcatcagcgcttttggtcccgatcatcat
gtcattcggttgagttttgggcggcatggcgatcacctacccaccgatgacgccgccatt
gtggcacacgctgccactgaagttcctgcactgtatggggtcagtgactgcgccgttgcg
gccagcgccgtggtgcggtggccggacgccttggccccggtgactcccacgatgcgtgcg
gtggcctccgctgcggtggcagcaaccacagattcgggtcttcacattgccggctcgtgg
gtggctggcactgggctagcagcgacgattcctcatgcccagggggttgctgagcgtatt
gtgaactga

  All links  
No link information was found.   
DBGET integrated database retrieval system