KEGG   Jonesia denitrificans: Jden_2493Help
Entry
Jden_2493         CDS       T00972                                 

Definition
uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
jde  Jonesia denitrificans
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:jde00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Jden_2493
Enzymes [BR:jde01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Jden_2493
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2678922..2679776
Genome map
AA seq 284 aa AA seqDB search
MTDPHHPLTGCTTLILRPEGRATPLITRITHAGGHTVTAPLITREPITTDQRATLDTHTA
ALHTYAWVAVTSVNAVDELIASIQRTHPTTPLTTVCTTTQWASVGPATTRALRAHGITVA
WEATENSASGMLAQWPAANTHTDPRTAVLLPLGNLATTQLETGLTSAGYTPTRVTTYLTV
AHPAPPSALAAWRAGRIDAVILTSGSIVEQFVAQFGHPSPGPGPAQGNEDRPVFVAIGEP
TRRAAQRHSLPIDAVARQASTAGLVDALVDAWTARTLAQPEGTL
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
gtgactgacccacaccacccactaaccggatgcaccacactcatcctgcgccccgaagga
cgagcaacccccctcatcacccgcatcactcacgccggcggacacacagtcaccgccccc
ctcatcacccgtgaacccatcaccaccgatcaacgcgccacccttgacacccacaccgca
gccctccacacctacgcctgggttgccgtcacctccgtcaacgccgtcgacgaactcatc
gcctccatccagcgcacccaccccaccacccccctcaccaccgtgtgcaccaccacccaa
tgggccagcgtcggccccgcaacaacccgtgcactgcgcgcccacggaatcaccgtggcc
tgggaagcaaccgaaaactccgcctcaggaatgctcgcccaatggccagccgccaacacc
cacaccgacccacgcaccgcagttctcctccccttgggaaacctcgccaccacccaactc
gaaaccggactcaccagcgccggatacacccccacccgcgtcaccacctacctcaccgtc
gcccaccccgccccaccaagcgcgctcgcagcgtggcgagctggacgcattgacgcggtg
atactcacctcaggcagtattgtggaacagtttgtcgcgcaattcgggcacccttcacca
ggccccgggcccgcccaggggaatgaggatcgccccgtttttgttgccatcggagagccc
acccgtcgtgcagcgcagcgtcattcgctgcccattgatgcggttgcccgccaggcaagc
actgcaggtcttgttgacgcgctcgttgatgcgtggactgcccgcacactcgcacaaccg
gaaggaacactgtga

  All links  
No link information was found.   
DBGET integrated database retrieval system