KEGG   Jonesia denitrificans: Jden_2494Help
Entry
Jden_2494         CDS       T00972                                 

Definition
porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
jde  Jonesia denitrificans
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:jde00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2679773..2680747
Genome map
AA seq 324 aa AA seqDB search
MKDRPRRLRTNAAMRALTRETHLHPRDLVLPVFVREGAGGALPIRSMPGVVQHTLDTLPD
VVATVEAAGLGGIMLFGVPEHRDATGSGATDPDGILNRAIAVAVTASTGNTVVMADLCLD
EFTDHGHCGVLTSDGGVDNDSTLVRYEEMAIAQARAGAAVVGLSGMMDGQVRAVRAALDD
AGFTDTAILAYSAKYASAFYGPFRDAVESTLDGDRRTYQMDYANRVEGSREADLDVLEGA
DIVMVKPAMSYLDVLADVADRVDVPVAAYQVSGEYAMIEAAAAHGWINRNAAIMESVHSI
RRAGATIIFTYWALEVATWLKDNG
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
gtgaaggaccgaccacgccgcttacggaccaacgccgccatgcgcgccttgacccgggaa
actcaccttcaccctcgtgacctggtgttaccggtgtttgtgcgagaaggggcaggaggg
gccctacccatccgatcgatgcctggggtcgtgcaacacaccctggacaccctgcctgat
gttgttgcaacagtggaggcagctgggcttggcggaatcatgctgtttggtgttcccgaa
caccgcgacgccacgggaagcggcgcaactgatccagacggcatcctcaatcgggccatt
gccgtggctgtcacagcgagcacaggaaataccgttgttatggctgatttgtgcctggat
gagttcaccgatcacggccattgcggggtcttgaccagtgacggtggtgtggataatgat
tccactcttgtccgctacgaggagatggcgatcgctcaggctcgggctggggctgccgtt
gttggcttatcaggcatgatggatggacaagtacgcgcggttcgtgccgctcttgacgat
gctggtttcactgacactgcgattcttgcctattcagcgaagtatgcgtcagcgttttat
ggaccgttccgtgacgcggtcgagtccactctggacggtgaccggcgcacctaccagatg
gactacgcaaaccgtgtggaagggtcacgtgaggcggatttggatgtgctggagggcgca
gacattgtcatggtgaaacctgccatgtcctatcttgatgttctggctgatgtggctgac
cgggtggatgtgccggttgccgcttatcaggtttctggtgagtacgcgatgattgaagcc
gcggcagctcatggatggatcaaccgaaatgcagcgatcatggagtctgttcactccatc
cgccgtgccggcgccaccatcattttcacgtactgggcccttgaggtcgccacttggtta
aaggacaacggatga

DBGET integrated database retrieval system