KEGG   Jeotgalibacillus malaysiensis: JMA_30590Help
Entry
JMA_30590         CDS       T03570                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
jeo  Jeotgalibacillus malaysiensis
Pathway
jeo00071  Fatty acid degradation
jeo00072  Synthesis and degradation of ketone bodies
jeo00280  Valine, leucine and isoleucine degradation
jeo00310  Lysine degradation
jeo00362  Benzoate degradation
jeo00380  Tryptophan metabolism
jeo00620  Pyruvate metabolism
jeo00630  Glyoxylate and dicarboxylate metabolism
jeo00640  Propanoate metabolism
jeo00650  Butanoate metabolism
jeo00900  Terpenoid backbone biosynthesis
jeo01100  Metabolic pathways
jeo01110  Biosynthesis of secondary metabolites
jeo01120  Microbial metabolism in diverse environments
jeo01130  Biosynthesis of antibiotics
jeo01200  Carbon metabolism
jeo01212  Fatty acid metabolism
jeo02020  Two-component system
Brite
KEGG Orthology (KO) [BR:jeo00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    JMA_30590
   00630 Glyoxylate and dicarboxylate metabolism
    JMA_30590
   00640 Propanoate metabolism
    JMA_30590
   00650 Butanoate metabolism
    JMA_30590
  Lipid metabolism
   00071 Fatty acid degradation
    JMA_30590
   00072 Synthesis and degradation of ketone bodies
    JMA_30590
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    JMA_30590
   00310 Lysine degradation
    JMA_30590
   00380 Tryptophan metabolism
    JMA_30590
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    JMA_30590
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    JMA_30590
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    JMA_30590
Enzymes [BR:jeo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     JMA_30590
Exosome [BR:jeo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   JMA_30590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AJD92376
UniProt: A0A0B5AQL5
Position
complement(2886638..2887816)
Genome map
AA seq 392 aa AA seqDB search
MPKTVIIDGARTPFGKMGGSLASFTASDLGAAAIKEALKRADIAPETIDEVILGTVLQGG
QGQIPSRQAAQKAGIPWEVKTETINKVCASGMRSVTLGDQLIRLGDESLIVAGGMESMTN
APYFMDKARSGFRMGDQMVKDMMVHDGLTCTFNNVHMGTYGNSTAEEFSLTREEQDAWAA
RSHKLAGDAIDNGVFAEEIVPLQVPQRKGDPITVENDESVRRGTTPETLAGLRPAFGKDG
TITAGNAPGINDGACAMVLMSDERAEKEGKTPLATILGHAEVAVEAKNFPQTPGLVINAL
LEKTGYKLEDIDLFEINEAFSAVALASNKIAKLDPEKVNVNGGAVALGHPIGASGARVIL
TLAYELKRRGGGLGIAAICSGGGQGDAVLIQV
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaaacagtaattattgacggagcaagaacacctttcggaaaaatgggcggatca
ctcgcatcattcacagcctcagaccttggagcagcagcaatcaaagaagcacttaagcgt
gcagacattgcaccggaaactatagatgaagtcatccttggaacagtcctgcagggtgga
cagggacaaatcccatcacgccaggcagcacaaaaagcaggcattccatgggaagtgaaa
acagaaacaatcaacaaagtatgtgcgtcaggcatgcgttcagtcacacttggagaccag
ctgatcagacttggagacgagtctctgattgttgcaggcggcatggagtcaatgacaaat
gcaccctattttatggataaagcaagatcaggcttccgcatgggagaccagatggtaaaa
gacatgatggttcacgatggactgacttgtacatttaataacgttcacatgggtacttac
ggaaactcaacagctgaagaattcagcctgacacgtgaagaacaggatgcatgggcagca
agaagccacaagcttgcaggcgatgcgattgataacggtgtttttgctgaagaaatcgtg
ccgcttcaggtgccgcagcgtaaaggtgacccaatcactgttgaaaacgatgaatcagtc
agaagaggaacgacacctgaaacacttgcaggtcttcgtccggcattcggaaaagacggc
acaatcacagcgggtaacgcacctggcatcaacgacggtgcatgcgcaatggtattaatg
agcgatgagcgcgccgaaaaagaaggcaagacgccgcttgcaaccattcttggacacgca
gaagtagcagttgaagcgaaaaacttcccgcagacacctggacttgtgatcaacgcactg
cttgaaaaaacaggctacaaactcgaagatatcgacctgtttgaaatcaatgaagcattc
tcagcagttgcactggcaagtaataaaattgccaagcttgaccctgaaaaagtaaacgtc
aacggaggcgcagtcgcacttggacacccaatcggcgcaagcggcgcgcgtgtcatcctg
acacttgcttacgaactcaaacgccgcggcggcggcctcggcatcgcagccatctgctca
ggcggaggccagggcgacgcagtactgattcaggtttga

DBGET integrated database retrieval system