KEGG   Juglans regia (English walnut): 109018686Help
Entry
109018686         CDS       T05245                                 

Definition
(RefSeq) beta-fructofuranosidase, insoluble isoenzyme 1-like
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
jre  Juglans regia (English walnut)
Pathway
jre00052  Galactose metabolism
jre00500  Starch and sucrose metabolism
jre01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:jre00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    109018686
   00500 Starch and sucrose metabolism
    109018686
Enzymes [BR:jre01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     109018686
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32C Glyco_hydro_32N
Motif
Other DBs
NCBI-GeneID: 109018686
NCBI-ProteinID: XP_018856378
UniProt: A0A2I4HJN4
Position
Unknown
AA seq 320 aa AA seqDB search
SGLETSVLGQNVKHVLKVSLDLTRYEYYTLGTYDPRSDRYVPDNTSADGWSGLRYDYGNF
YASKTFFDAGKNRRILWGWANESDTPNNDTSKGWAGIQLIPRTVWLDTSGKQLLQWPIKE
LETLRGEKVHISNQQIKQGDHFEVKGITAAQADVDVTFRLSSLDTAEQFDPSWVDAQALC
GQKGSTVQGGIGPFGLLTLASENLEEYTPVFFRVFKASEGHVVLMCSDARSSSLRRELYR
PSFAGFVNVNLADGKLSLRSLIDHSVVESFGAQGKTCITSRVYPTLAVFQDAHLYAFNNG
SEIVTIENLNAWSMKSGQIS
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
agtgggttggaaacatcagttcttgggcaaaacgtaaagcatgtgttgaaggtgagtctt
gatcttaccaggtacgagtactatacacttggaacatacgatcctcgatctgataggtat
gtacctgataacacatctgccgatggatggagtggtctaagatatgactacggaaacttt
tatgcctcaaagaccttctttgatgccgggaagaaccgaaggattttgtggggttgggct
aatgaatcggatacgcctaataacgatacttctaaagggtgggctgggattcagcttatt
ccgaggacggtgtggcttgacacttctgggaagcaattgttacaatggcctattaaagaa
ttggaaactcttagaggggagaaagttcatataagcaatcaacagatcaaacagggagat
cactttgaggtcaaaggaattactgctgctcaggccgatgttgatgtaacctttcggcta
tcaagcttggatacggccgagcaatttgatcctagctgggttgacgcacaagcactatgt
ggccaaaagggctcgacagttcaaggcgggattggtccatttgggttgttgacactagct
tcagaaaatctagaagaatatactcctgtcttctttagagttttcaaagcttcagagggg
catgtagttctcatgtgctctgatgcaagaagttcctctttgagacgtgagctatatcga
ccatcatttgcaggcttcgtaaacgtgaatttagcagacgggaagctttctcttaggagt
ttgattgatcattccgtcgtggaaagttttggagcacaagggaaaacgtgcatcacatca
agggtttatcccacacttgcagtcttccaagatgctcacttgtacgcatttaacaacggg
tcagagattgttaccatagagaatctaaatgcatggagcatgaaaagcggtcaaataagc
taa

DBGET integrated database retrieval system