KEGG   Kazachstania africana: KAFR_0A00410Help
Entry
KAFR_0A00410      CDS       T02487                                 

Gene name
KAFR0A00410
Definition
hypothetical protein
Orthology
K11401  
histone acetyltransferase SAS2 [EC:2.3.1.48]
Organism
kaf  Kazachstania africana
Brite
Enzymes [BR:kaf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     KAFR_0A00410 (KAFR0A00410)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:77338..78348
Genome map
AA seq 336 aa AA seqDB search
MPGKKHQATVAGGEPSKLKVKKRGKKKTFLEKDHLYGILEKRNINRVKFGVDKVFDTWYG
SNVYFNLDTLKLGCIEDDDDDDEHNNVDTNAAESIWLDTLYVCEYCFKYTDNNVKLMKHS
QLCSFKRKAPGRIKYKSPEYTIRRVKGSKHKLFCQCLCLFTKLFLDNKSMFFRLDNYDFY
ILYETGSTKPMGFFSKDLVSYNQNNLACILVFPPYQRRNLGTLLIEFSYKLSKLDSIVSG
PEVPLSPFGLISYLKVWSQLLCYHLLEGDLTTMGGISLKQLSSVTGLRINDIIMTLKHLN
CIGDDNKIYLSILRTWMNKHGKNGFMVQDEYLLLDD
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgcctggcaagaaacatcaagcaacggtggctggaggcgagccgagtaagttgaaggtg
aagaagagaggcaagaagaagacgtttctggagaaggatcatttgtacggtatcttggag
aagagaaacatcaacagggtgaagtttggcgtcgataaggtgtttgacacatggtacggt
agtaatgtgtattttaatctggatacattgaaattgggttgtatagaggacgatgatgat
gatgatgaacataacaatgttgatacaaatgctgctgagtccatctggttggacaccttg
tatgtctgtgaatattgcttcaaatacacagataacaacgtaaagttgatgaaacattct
caattgtgcagtttcaaaaggaaagcacccggtagaatcaagtataaatctccagagtac
actatacgaagagtgaagggatccaaacacaagttgttttgtcaatgtctgtgtctgttc
actaagttgtttctggataacaagtctatgtttttcagattggataattacgatttttac
attttgtatgaaacaggttccaccaagccaatggggtttttctcaaaagacctggtttca
tataatcagaacaatttagcctgtattttggttttcccaccatatcaaaggcgtaatctc
ggtacgttgttgattgagttctcatacaagttatcgaaattggatagtatcgtctctgga
ccagaagttcccttgtcaccctttggcttgataagttatctgaaagtctggtcccagcta
ctgtgctaccatttgcttgaaggagatctaaccaccatgggcggtatttctttgaagcaa
ttatcttcagtgacgggactgagaatcaacgatattattatgactttgaaacatttgaat
tgcataggagacgataataaaatatatttgagtatcctaagaacctggatgaataaacat
ggcaagaacggtttcatggttcaggatgaatatctgttattggacgattag

DBGET integrated database retrieval system