KEGG   Kazachstania africana: KAFR_0A01210Help
Entry
KAFR_0A01210      CDS       T02487                                 

Gene name
KAFR0A01210
Definition
hypothetical protein
Orthology
K00128  
aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
kaf  Kazachstania africana
Pathway
Glycolysis / Gluconeogenesis
Pentose and glucuronate interconversions
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Arginine and proline metabolism
Histidine metabolism
Tryptophan metabolism
beta-Alanine metabolism
Glycerolipid metabolism
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:kaf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KAFR_0A01210 (KAFR0A01210)
   00040 Pentose and glucuronate interconversions
    KAFR_0A01210 (KAFR0A01210)
   00053 Ascorbate and aldarate metabolism
    KAFR_0A01210 (KAFR0A01210)
   00620 Pyruvate metabolism
    KAFR_0A01210 (KAFR0A01210)
  Lipid metabolism
   00071 Fatty acid degradation
    KAFR_0A01210 (KAFR0A01210)
   00561 Glycerolipid metabolism
    KAFR_0A01210 (KAFR0A01210)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    KAFR_0A01210 (KAFR0A01210)
   00310 Lysine degradation
    KAFR_0A01210 (KAFR0A01210)
   00330 Arginine and proline metabolism
    KAFR_0A01210 (KAFR0A01210)
   00340 Histidine metabolism
    KAFR_0A01210 (KAFR0A01210)
   00380 Tryptophan metabolism
    KAFR_0A01210 (KAFR0A01210)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    KAFR_0A01210 (KAFR0A01210)
Enzymes [BR:kaf01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     KAFR_0A01210 (KAFR0A01210)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(234559..236049)
Genome map
AA seq 496 aa AA seqDB search
MSHEKADAVTITLPNGITYEQPVGLFINNEFIKSSDAKKIPVENPSTEENVVDVYSGTKD
DVEYAVEVAENAFFNTEWSTQDPKVRARYLSKLADLVEEETELISSIESLDNGKTLALSR
GDVGLVVNCLRDAASYADKINGRTIDTGDGYMNFTVREPIGVCGQIIPWNFPLMMLSWKI
APALAMGNVIILKPASATPLNALYFASLCKRVGIPPGVVNIIPGSGRQVGTTITEHPRIR
KVAFTGSTDIGKDIAIRASSVNLKKITLELGGKSAHLVFDDVNIEKTLPNLVNGIFKNAG
QICSSGSRIYVQEGVYDKLLPAFKAYVENLKVGSPFDEANFQGAITNKGQFDTIMDYIKI
GKDEGAKVLTGGERIGDKGYFVRPTIFYDVHEDMRIVKEEIFGPVVTISKFKTIEDGVAM
ANASEFGLGAGIETENLSTALRVAKMLKSGTVWVNTYNDFDSRVPFGGVKQSGYGREMGI
EVYDCYTEVKAVRIKL
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgtcacacgaaaaagccgatgccgtcacaatcactttaccaaacggtataacatacgaa
caaccagtaggtttattcattaacaacgaattcataaaatcatctgatgctaagaaaatc
ccagtagagaacccatcaactgaagaaaatgtcgttgatgtatactcaggtactaaagat
gacgtagaatacgccgttgaagtcgctgaaaacgcttttttcaacaccgaatggagtaca
caagatccaaaagttagagctagatacctctcaaaattagcagatctcgttgaagaagaa
acagaattaatctcttctatcgaatccttagataacggtaagactctagccttgtctaga
ggtgacgtcggtttagtcgtcaactgtttgagagatgccgcttcttatgccgataaaatc
aatggtagaaccattgacactggtgatggctacatgaacttcaccgtaagagaaccaatt
ggtgtctgtggtcaaatcatcccatggaatttcccattgatgatgttatcatggaaaatt
gccccagctttagcaatgggtaacgtcatcattttgaaacctgcttctgctaccccatta
aacgccctatattttgcctctctatgtaagagggtaggtatcccacctggtgttgttaac
attatcccaggttccggtagacaagtcggtactaccatcaccgaacatccaagaattaga
aaggttgccttcactggttccaccgacatcggtaaggatatcgctattagggcctctagt
gtcaacttgaagaagattactttagaattaggtggtaaatctgctcatttagtctttgac
gatgtcaacattgaaaagaccttaccaaacttagttaacggtatctttaagaacgctggc
cagatttgttcttctggttccagaatctacgttcaagaaggtgtctacgacaaattatta
cctgctttcaaagcgtacgtcgaaaacttaaaggtcggttctccattcgatgaagcaaat
ttccagggtgctatcaccaacaaaggacaattcgatactatcatggattacatcaagatc
ggtaaggatgaaggtgcaaaggttctaactggtggtgaaagaatcggtgacaaaggttac
ttcgttagaccaactattttctacgatgttcatgaagatatgagaatcgtcaaggaagaa
atctttggtcctgtcgtcactatttccaaattcaagaccattgaagatggtgtcgctatg
gctaacgcttctgagttcggtttaggtgccggtattgaaactgagaacctatccaccgct
ttaagagttgctaagatgttgaaatccggtactgtctgggtcaacacctacaacgatttc
gattctagagtcccattcggtggtgtcaagcaatccggttacggtagagagatgggtatc
gaagtctacgactgttacactgaagtcaaggctgtcagaatcaaactataa

DBGET integrated database retrieval system