KEGG   Kazachstania africana: KAFR_0A01210Help
Entry
KAFR_0A01210      CDS       T02487                                 

Gene name
KAFR0A01210
Definition
hypothetical protein
Orthology
K00128  
aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
kaf  Kazachstania africana
Pathway
Glycolysis / Gluconeogenesis
Pentose and glucuronate interconversions
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Arginine and proline metabolism
Histidine metabolism
Tryptophan metabolism
beta-Alanine metabolism
Glycerolipid metabolism
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:kaf00010]
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:kaf00040]
Metabolism; Carbohydrate metabolism; Ascorbate and aldarate metabolism
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:kaf00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:kaf00640]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:kaf00071]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:kaf00561]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:kaf00280]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:kaf00310]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:kaf00330]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:kaf00340]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:kaf00380]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:kaf00410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(234559..236049)
Genome map
AA seq 496 aa AA seqDB search
MSHEKADAVTITLPNGITYEQPVGLFINNEFIKSSDAKKIPVENPSTEENVVDVYSGTKD
DVEYAVEVAENAFFNTEWSTQDPKVRARYLSKLADLVEEETELISSIESLDNGKTLALSR
GDVGLVVNCLRDAASYADKINGRTIDTGDGYMNFTVREPIGVCGQIIPWNFPLMMLSWKI
APALAMGNVIILKPASATPLNALYFASLCKRVGIPPGVVNIIPGSGRQVGTTITEHPRIR
KVAFTGSTDIGKDIAIRASSVNLKKITLELGGKSAHLVFDDVNIEKTLPNLVNGIFKNAG
QICSSGSRIYVQEGVYDKLLPAFKAYVENLKVGSPFDEANFQGAITNKGQFDTIMDYIKI
GKDEGAKVLTGGERIGDKGYFVRPTIFYDVHEDMRIVKEEIFGPVVTISKFKTIEDGVAM
ANASEFGLGAGIETENLSTALRVAKMLKSGTVWVNTYNDFDSRVPFGGVKQSGYGREMGI
EVYDCYTEVKAVRIKL
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgtcacacgaaaaagccgatgccgtcacaatcactttaccaaacggtataacatacgaa
caaccagtaggtttattcattaacaacgaattcataaaatcatctgatgctaagaaaatc
ccagtagagaacccatcaactgaagaaaatgtcgttgatgtatactcaggtactaaagat
gacgtagaatacgccgttgaagtcgctgaaaacgcttttttcaacaccgaatggagtaca
caagatccaaaagttagagctagatacctctcaaaattagcagatctcgttgaagaagaa
acagaattaatctcttctatcgaatccttagataacggtaagactctagccttgtctaga
ggtgacgtcggtttagtcgtcaactgtttgagagatgccgcttcttatgccgataaaatc
aatggtagaaccattgacactggtgatggctacatgaacttcaccgtaagagaaccaatt
ggtgtctgtggtcaaatcatcccatggaatttcccattgatgatgttatcatggaaaatt
gccccagctttagcaatgggtaacgtcatcattttgaaacctgcttctgctaccccatta
aacgccctatattttgcctctctatgtaagagggtaggtatcccacctggtgttgttaac
attatcccaggttccggtagacaagtcggtactaccatcaccgaacatccaagaattaga
aaggttgccttcactggttccaccgacatcggtaaggatatcgctattagggcctctagt
gtcaacttgaagaagattactttagaattaggtggtaaatctgctcatttagtctttgac
gatgtcaacattgaaaagaccttaccaaacttagttaacggtatctttaagaacgctggc
cagatttgttcttctggttccagaatctacgttcaagaaggtgtctacgacaaattatta
cctgctttcaaagcgtacgtcgaaaacttaaaggtcggttctccattcgatgaagcaaat
ttccagggtgctatcaccaacaaaggacaattcgatactatcatggattacatcaagatc
ggtaaggatgaaggtgcaaaggttctaactggtggtgaaagaatcggtgacaaaggttac
ttcgttagaccaactattttctacgatgttcatgaagatatgagaatcgtcaaggaagaa
atctttggtcctgtcgtcactatttccaaattcaagaccattgaagatggtgtcgctatg
gctaacgcttctgagttcggtttaggtgccggtattgaaactgagaacctatccaccgct
ttaagagttgctaagatgttgaaatccggtactgtctgggtcaacacctacaacgatttc
gattctagagtcccattcggtggtgtcaagcaatccggttacggtagagagatgggtatc
gaagtctacgactgttacactgaagtcaaggctgtcagaatcaaactataa

DBGET integrated database retrieval system