KEGG   Kazachstania africana: KAFR_0A02930Help
Entry
KAFR_0A02930      CDS       T02487                                 

Gene name
KAFR0A02930
Definition
hypothetical protein
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
kaf  Kazachstania africana
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:kaf00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    KAFR_0A02930 (KAFR0A02930)
Enzymes [BR:kaf01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     KAFR_0A02930 (KAFR0A02930)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:609450..610400
Genome map
AA seq 316 aa AA seqDB search
MDQLEDNTHNILDEPLHGIVIPSGLFITGILLMTYMSSDKRILFALPVLFSVVLTRFISA
YQRRQSLFKDRWTQLELEDQTLVSKNTAIYRFKLKTKLESLDIPAGHHVAVKMNIDGKDE
IRYYNPISSKLAKGYVDLMVKSYPNGKVSKQFASLTTGSLVDFMGPMGQFHYKPNSSKEL
AIVAGGSGITPILQVLNEIITVPEDVTKVSIIYANVTENDILLKDELDEICFKYPNVRIH
YVLDKPKYAEAWRGDVGFVTKEQMQQYLPLPNPDNRLLICGPEQMESLVLKYAEELGWNC
PVTNRSNADDQVFVFN
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atggaccaattggaagataacacacacaacatcctggatgagcctctacacggtattgtc
attccctctggtttattcattaccggtattttgttaatgacttatatgtcctctgataaa
agaatactgttcgctttaccagtattattcagtgtagtattaactaggttcatttcggcc
tatcaacgtcgacaatcattgttcaaagataggtggactcagttagaattagaagaccaa
accctagtatccaaaaatacagccatttatcgtttcaaattgaagacaaagttagaatca
ttagatatcccagctggtcaccatgtagcagtcaaaatgaacattgatgggaaggacgaa
ataagatattacaaccctatcagctctaaattagcaaagggctacgtcgatcttatggtg
aaatcttatcccaatggcaaagtttccaaacaattcgcaagtctaaccactggttcttta
gtagactttatgggacctatgggccaattccattataagccaaattcttccaaagagtta
gccatcgtggctggtggttccggtattacaccaattttacaagtcttgaatgaaattatt
actgttcctgaagatgtaaccaaggtatctataatttacgctaatgttactgaaaatgac
atcctattgaaggatgaattggatgaaatatgctttaaatacccaaatgttagaattcat
tacgtattagataaaccaaagtatgctgaggcatggagaggtgatgttggatttgttaca
aaggaacaaatgcagcaatatctaccactaccaaatcccgataatagactgttgatttgt
ggtccagaacaaatggaaagcttggttttgaaatatgctgaagaactcggttggaattgt
ccagttaccaacagatccaatgctgacgatcaagtttttgtattcaactaa

DBGET integrated database retrieval system