KEGG   Kazachstania africana: KAFR_0A03850Help
Entry
KAFR_0A03850      CDS       T02487                                 

Gene name
KAFR0A03850
Definition
hypothetical protein
Orthology
K11304  
histone acetyltransferase HTATIP [EC:2.3.1.48]
Organism
kaf  Kazachstania africana
Brite
Enzymes [BR:kaf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     KAFR_0A03850 (KAFR0A03850)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:782907..784241
Genome map
AA seq 444 aa AA seqDB search
MTPEVETDIGKPRNIDSVEELVIKAQCWVKKDNDERLAEILSINTRRSPPKFYVHYVNYN
KRLDEWILTDRINLEKEVIFPVPKIQDDEKKRQKKKKTPVSKTLTDLTDGESRRSETPEP
SDVMDLDNLNVQGINQDISQEDEIKKLRTSGSMTQNPHEVARVRNLSKVIMGKYEIEPWY
FSPYPVELTDEDQIYIDDFTLQYFGSKKQYERYRKKCTLRHPPGNEIYRDDYVSFFELDG
RKQRTWCRNLCLLSKLFLDHKTLYYDVDPFLFYCMTRRDELGHHLVGYFSKEKESADGYN
VACILTLPQYQRMGYGKLLIEFSYELSKKEGKVGSPEKPLSDLGLLSYRAYWSDTLITLL
AEYGRDITIDEISSMTSMTTTDILHTTKTLNVLRYYKGQHIIFLNDDILKRYEVLKAKNR
RKIDPEKLIWKPPVFTASQLRFAW
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgactccagaagtggagactgatatcggaaaacctagaaatatagattctgtggaagag
ttagttattaaagctcagtgttgggttaaaaaagataacgatgagagattagcagaaatt
ttatctataaatacaagaagatcgccacccaaattttatgttcattatgttaactataac
aagcgtttagatgaatggattctgactgatcgaataaatctggagaaagaagtgatattc
cctgtacccaaaattcaagatgatgaaaagaaaaggcagaagaagaagaaaacaccggtt
tcaaaaaccttaacagacttgacagatggagaaagccgaagatctgagacacctgagccc
tcagatgtgatggatctggataatttaaatgtccaaggtattaatcaagacatatcacaa
gaagacgaaattaagaagttaaggacctctggttccatgactcaaaatccccatgaagtt
gcccgagtaaggaatttatctaaggttattatgggaaagtacgaaattgagccatggtat
ttctctccatatcccgttgaattaacagatgaggatcaaatttacatcgatgacttcacg
ttacaatattttggatccaaaaagcaatacgaaagatacagaaagaagtgtacactacga
caccctcctggaaatgagatttacagggatgattacgtttcgttttttgaattagatggt
agaaaacagagaacatggtgtagaaatttatgtctactctctaagctgtttttggatcat
aaaacgttgtactatgatgtcgatccatttttgttctattgtatgacacgaagagacgaa
ttgggccatcacctggtcggatacttttccaaagaaaaagaatctgcagatggttataat
gttgcatgtattctaactttaccacaatatcagagaatggggtatggtaaattgttaatt
gaattttcatatgaactttccaagaaagaaggtaaagtaggatcacctgaaaagccttta
tctgatttgggtttattgtcttatagggcatactggtctgacactttaataacattactt
gctgaatatggcagggatattacgatagacgagataagttccatgacgtcaatgacaacc
actgacattttgcatactacaaagacgctgaatgtattaagatattataaaggacaacac
attatttttttaaatgacgatattttgaaaagatacgaagtgctaaaggccaagaataga
aggaagattgatccagaaaagcttatttggaagccgccagtattcactgcatctcaatta
agatttgcctggtag

DBGET integrated database retrieval system