KEGG   Kazachstania africana: KAFR_0A04180Help
Entry
KAFR_0A04180      CDS       T02487                                 

Gene name
KAFR0A04180
Definition
hypothetical protein
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
kaf  Kazachstania africana
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:kaf00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    KAFR_0A04180 (KAFR0A04180)
Enzymes [BR:kaf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     KAFR_0A04180 (KAFR0A04180)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:840286..841053
Genome map
AA seq 255 aa AA seqDB search
MTKQIIFLKNKTVPEDKYATESGLYDYDKITHLPLIQHRHCPEDLLKLLRDPSYMISLRY
LIVTSQRSVECINESILPYIDEQSKRKLLNSTVFTVGPSTAEFLRRIGFEDVRGEETGNG
DMLADYIIENIPSFDGEFLFLVGRTRKEIIKNKLSNGHFNVREMIVYETAPLDRNLSRFK
DELLVDAIAWLVFFSPQGTDEIIEYIKDCKSDIQFKIASIGPSTEKFLVKHSLAPDVVSP
HPEPKSLLKSIEKHH
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagcagattatatttcttaaaaataaaacagtccctgaggataaatatgccact
gaatctggcctctatgactatgacaagattacacatttaccattaattcagcatcgacat
tgccccgaagatctgttaaagcttctcagagacccctcatatatgatttcattacgatac
ctcattgtaacctcacaacgatcggtggaatgcattaatgagtctattttgccttatatt
gatgaacaatcgaaaagaaaactacttaattcaacagtctttacggtgggtccctccaca
gcagaatttcttcgtagaattggattcgaggatgttcgaggtgaagaaactggaaatggt
gatatgttggcagattacataatagagaacataccatcatttgatggggagtttttattt
ctagttggaagaactagaaaagaaataatcaaaaataagctgtctaatggtcacttcaac
gttagagaaatgatagtatatgaaacagcacctctagaccgaaatctttcaagatttaaa
gatgagctacttgttgatgcaatcgcatggcttgtgtttttcagcccccaaggcacggat
gaaataatcgaatatataaaagattgtaaatctgacatccaatttaaaatagctagtatt
ggaccctccactgagaaattcttagtgaaacatagcttagcaccagatgtagtaagtcct
catccggaaccaaaatcattattaaaatccatcgaaaagcatcattaa

DBGET integrated database retrieval system