KEGG   Kazachstania africana: KAFR_0A04270Help
Entry
KAFR_0A04270      CDS       T02487                                 

Gene name
KAFR0A04270
Definition
hypothetical protein
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
kaf  Kazachstania africana
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:kaf04141]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(849458..850423)
Genome map
AA seq 321 aa AA seqDB search
MRSVRNIYILFWISLITSVLAQNFYDSDPHIIELTTKNFDQVIHNTNYTSLVEFYAPWCG
YCKKLKPTMHKVAKKLGGTIQVATVNCDLQKNKQLCSQHQIQGFPTLMIFTPPKLSLQKK
MKESGESTKHFNEPYNGERSLSYITDFALSRMKTYVKKLVHMDKLKAVLDKSSKTKRFSV
LLFSKNDKITPMFKSMAIDWLDKCDFYQFHNKKLSKLTSGNELFISYPHISTSLNDLLES
QSKSSKSKLVILDGLQDEIYVFEGQQINKVEVANFISDTLDILPREGPLSKRHNFLKILQ
SGKKSKPSKSHKKSQSKHDEL
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgcgttctgtacgaaatatttatatcttattttggataagcttgattacttcagtccta
gcccaaaatttctatgattcagatccacatataatcgaattaacaactaaaaactttgat
caagtcattcacaataccaattatacctcgttggttgaattttatgccccatggtgtgga
tattgtaagaaattgaaacccacaatgcataaagttgctaagaagcttggtgggactatc
caagttgcgacagtgaactgtgatttacagaagaacaaacaactatgttcacaacatcaa
attcaaggtttccctactttaatgatatttacgccccctaaattaagcctccaaaagaag
atgaaagagtctggagaatctactaaacatttcaatgaaccttataatggagaacggtct
cttagctacattactgactttgccctatcaagaatgaagacatacgttaagaaattagtt
catatggataagcttaaagcggtattagacaaatcttcgaaaactaaaagattctcggtc
cttttattttccaagaatgacaaaattactcctatgttcaaaagtatggctattgattgg
ctagataaatgtgatttttatcagtttcataataaaaaattgagcaaactgactagtggt
aacgaattgtttatttcttatccacatatttcgacatctttgaacgatttactcgaatct
caaagcaaaagtagtaaaagtaaactagtgatactagacggtttacaggatgaaatatat
gtttttgaagggcaacaaattaataaagttgaagttgccaattttatttccgatactctc
gatatcttaccaagagaggggccgctaagtaaacgtcacaatttcttgaaaattttacaa
tcaggtaaaaaatccaaaccgtccaaatcacacaagaaatcacaaagtaagcatgatgaa
ttgtaa

DBGET integrated database retrieval system