KEGG   Kazachstania africana: KAFR_0A04270Help
Entry
KAFR_0A04270      CDS       T02487                                 

Gene name
KAFR0A04270
Definition
hypothetical protein
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
kaf  Kazachstania africana
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:kaf00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    KAFR_0A04270 (KAFR0A04270)
Enzymes [BR:kaf01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     KAFR_0A04270 (KAFR0A04270)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(849458..850423)
Genome map
AA seq 321 aa AA seqDB search
MRSVRNIYILFWISLITSVLAQNFYDSDPHIIELTTKNFDQVIHNTNYTSLVEFYAPWCG
YCKKLKPTMHKVAKKLGGTIQVATVNCDLQKNKQLCSQHQIQGFPTLMIFTPPKLSLQKK
MKESGESTKHFNEPYNGERSLSYITDFALSRMKTYVKKLVHMDKLKAVLDKSSKTKRFSV
LLFSKNDKITPMFKSMAIDWLDKCDFYQFHNKKLSKLTSGNELFISYPHISTSLNDLLES
QSKSSKSKLVILDGLQDEIYVFEGQQINKVEVANFISDTLDILPREGPLSKRHNFLKILQ
SGKKSKPSKSHKKSQSKHDEL
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgcgttctgtacgaaatatttatatcttattttggataagcttgattacttcagtccta
gcccaaaatttctatgattcagatccacatataatcgaattaacaactaaaaactttgat
caagtcattcacaataccaattatacctcgttggttgaattttatgccccatggtgtgga
tattgtaagaaattgaaacccacaatgcataaagttgctaagaagcttggtgggactatc
caagttgcgacagtgaactgtgatttacagaagaacaaacaactatgttcacaacatcaa
attcaaggtttccctactttaatgatatttacgccccctaaattaagcctccaaaagaag
atgaaagagtctggagaatctactaaacatttcaatgaaccttataatggagaacggtct
cttagctacattactgactttgccctatcaagaatgaagacatacgttaagaaattagtt
catatggataagcttaaagcggtattagacaaatcttcgaaaactaaaagattctcggtc
cttttattttccaagaatgacaaaattactcctatgttcaaaagtatggctattgattgg
ctagataaatgtgatttttatcagtttcataataaaaaattgagcaaactgactagtggt
aacgaattgtttatttcttatccacatatttcgacatctttgaacgatttactcgaatct
caaagcaaaagtagtaaaagtaaactagtgatactagacggtttacaggatgaaatatat
gtttttgaagggcaacaaattaataaagttgaagttgccaattttatttccgatactctc
gatatcttaccaagagaggggccgctaagtaaacgtcacaatttcttgaaaattttacaa
tcaggtaaaaaatccaaaccgtccaaatcacacaagaaatcacaaagtaagcatgatgaa
ttgtaa

DBGET integrated database retrieval system