KEGG   Kazachstania africana: KAFR_0A04740Help
Entry
KAFR_0A04740      CDS       T02487                                 

Gene name
KAFR0A04740
Definition
hypothetical protein
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
kaf  Kazachstania africana
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:kaf01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:kaf01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:942850..944301
Genome map
AA seq 483 aa AA seqDB search
MSPTLTGTVMANAAFEEDPTRYEEVDVKHANIIATGLNKKQLRVVNGLGSFMGSKEMVDL
SLKTPKLHISEQPWTFSNWYKHLNWLNIILVIVIPLIGWMVYFTNAVPLKRETFYFAIFY
YGIGGLSITAGYHRLWSHRSYSAIWPLRLFFAFFGAASVEGSIKWWGHSHRIHHRYTDTK
RDPYDARRGLFYSHMGWMILKPNPKYKARADISDLNDDWIVRFQHRHYIPIMVLSAFIVP
SLVCGHFFDDYLGGFIYAGIIRVFMIQQATFCINSMAHYIGTQPFDDKRTPRDNWLTALV
TFGEGYHNFHHEFPTDYRNAIKWYQYDPTKVFIYLSSIIGLSSNLKKFPQNAIEQGLIQQ
IEKKINSQKRNLNWGPRLTDLPVWNYSEFQRQIEKNERKLTIIGGVVHDVTDFINEHPGG
EPLIKEALGKDATRVFSGGVYSHSNAAYNILATLRVAVINEKQNTAVTFARKRGEKYDRT
KAN
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgtctcccacattaacaggtaccgtcatggctaatgctgcttttgaagaagacccaact
cgatacgaagaggtggatgttaaacatgcaaatataatagctacaggtttgaataagaag
caattaagagttgtcaacggtcttggatcatttatgggctcgaaagaaatggttgatctc
agtctcaaaactccaaaattacatatatcagaacagccatggacgttttcaaattggtat
aaacatttaaactggttaaacattatactggttatagtcataccattgatcggatggatg
gtatatttcaccaatgcagtgccattgaaaagagaaactttttatttcgctatattttac
tatggtattggaggactttcaataactgctggctatcataggttatggtcacacagatca
tattccgcaatatggccattgagactgttttttgctttttttggcgctgcatctgtagaa
ggttctattaaatggtggggccactctcatagaattcaccatagatacactgacactaag
agagatccatatgatgcaagacgtggtctcttttattcgcatatgggttggatgatcttg
aagccaaatccgaaatacaaagctagggctgacatttctgatttaaatgacgattggata
gttagatttcaacaccgtcactacattcctatcatggtactttccgcatttattgttcca
tctcttgtctgtggacatttcttcgacgattatttgggtggattcatatacgccggaata
ataagagtctttatgatacagcaagctaccttttgtatcaattcaatggcgcattatatt
ggcacacaaccttttgatgataaaagaactcctcgtgataattggctcactgcattggtc
acatttggtgaaggctaccataatttccaccatgaatttcctactgattacagaaatgca
attaaatggtaccaatacgatccaactaaagtttttatttacttatcctcaataattggt
ctttcttccaatctgaaaaaattcccacaaaatgcaattgaacaaggtttaattcaacag
attgaaaaaaaaattaattcacagaaaagaaacttaaattggggcccaagacttacagac
ttaccagtttggaattatagtgaatttcaaaggcaaattgaaaaaaatgaaaggaaatta
actattatcggtggagttgttcatgatgtcacagatttcataaatgagcatcccggtggt
gaaccattgatcaaggaggcattaggtaaagatgccacaagagtatttagcggaggtgtt
tattctcattcaaatgctgcttataatatcttggctacattaagagtcgctgtaatcaat
gagaaacaaaataccgctgtaacttttgcccgtaaaagaggtgaaaaatatgacagaaca
aaggctaattga

DBGET integrated database retrieval system