KEGG   Kazachstania africana: KAFR_0A05050Help
Entry
KAFR_0A05050      CDS       T02487                                 

Gene name
KAFR0A05050
Definition
hypothetical protein
Orthology
K10777  
DNA ligase 4 [EC:6.5.1.1]
Organism
kaf  Kazachstania africana
Pathway
Non-homologous end-joining
Class
Genetic Information Processing; Replication and repair; Non-homologous end-joining [PATH:kaf03450]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1003515..1006361
Genome map
AA seq 948 aa AA seqDB search
MDLTVPEVEVPRNFAPSPQFKWLCEELFSKLEEVPNQRHLTTKRITLRYYEIITNFVNLW
RTTVGDDIYPALILALPYRDRRMYNVKDYTLIKAICTYLKLPKNSFTEKRLLNWKQRADR
SVKLSVSCVNEMRKRKSEPVEKSPITLDELNTLLDFLSQDRNIKGRGYKNLSESSIFTYC
IEKMSFMELRYFFDIILKARVIGPHEHKLLNAWHPDAEDYLSVVSDLKTVCTRLWNPNIR
LRHDELSINIGYAFAPHLAKKLSISYDKICKKLKNDFFIEEKMDGERIQIHYMDYGNDIK
FLSRRGVDYTYLYGENLSTGTIACYLKLNRDVKECVLDGEMVTYDEDQDILLPFGMVKSA
AMNALTKEEISGQDYHPLLMVFDLVFLNGSSLVEFPLYQRKDYLASVLEPYRARVQIVNF
TRCSNENIIRKSLEHAISVGSEGIVLKNYNSRYMIGSRNDSWIKIKPEYLEQFGENMDLI
VIGRDSAKKDSFYCGLTVLDEEEEKLVEEIDKGVVNLVSDESDYENPENNRHIKKVVSFC
MIANGISQNEYKEIYRKTRGFWKKTEEVPPPPELIEFGTQVPMEWIEPEHSVVLEIKARS
LDNTESSCKRFKAGCTLYGGYCRRIRDDVDWKSSFSLAELRRDRRIKHYPGTSEKDTLLK
SKKRRKKQLLTPLNQNLNPRDIQTTSKIFDGLFFYILSDYFDTNENVRISKDDLQKLLLE
NGGKISHNIVSKRESKSNLRILCGKYTAECNVLIKRGYDILSPQWVIDCVENKKIVKIEP
SHCFSVSDDLMALAMRRVDKYGDSYESLLSVSRLSYILRSSKDISPDLLSPANMSLDFEK
VPYFLFWRRKAFVMEHNFDKSSIRETILKIQLYGGKVVKNISECNIVIFPKAEITVIRES
MKFIRNTLAKTVSTSVELPMLPRIVSFEWIDASIEKNVQVPEEDYVPM
NT seq 2847 nt NT seq  +upstreamnt  +downstreamnt
atggatctaaccgtaccagaagttgaagttcccaggaatttcgcaccttctcctcagttc
aaatggctgtgtgaggagttattttcgaaactagaagaggttccaaaccagagacattta
acaacaaaaagaataacattgaggtactacgaaatcatcactaattttgttaatctttgg
agaacaactgtaggcgatgacatatatcctgctctaatattggctttaccttatagggat
agaagaatgtacaatgttaaagactatacattgatcaaagcaatttgtacatatttgaag
ctaccaaagaattcattcacagaaaagcgactactgaattggaaacaaagagctgatcga
agcgtcaaactgtctgtgtcttgtgtgaatgaaatgcgcaaaaggaagagtgaaccagtc
gaaaaatcgcccattacacttgatgaactgaacaccttattagacttcctaagtcaagat
agaaacataaaaggacgcggctacaaaaacttatctgagtcttctattttcacttattgc
attgaaaagatgtcatttatggagttaaggtacttttttgatattatactcaaagcaaga
gttataggtccacatgaacataaacttttgaatgcatggcacccagatgctgaagattat
ttgagtgttgtttcagacctaaaaactgtatgtacaaggctttggaatccgaatatcaga
ctgcggcacgacgagctatcaatcaatattggatatgcttttgctcctcatttagccaag
aaattgagtatatcatacgataaaatttgtaaaaaattgaagaatgatttctttatagaa
gaaaaaatggatggcgaacgaatacaaatccattacatggattatggcaacgacattaaa
ttccttagcaggcgtggtgtagattacacatatttatatggtgagaacctgagtactggt
acgattgcatgctacctgaaacttaacagggatgtcaaagaatgtgtgttggatggtgag
atggttacctacgatgaggatcaagatatattactaccctttggaatggtaaaaagtgca
gcaatgaacgcattaactaaggaagaaatttctggacaagactatcatccccttttgatg
gtttttgacttggtttttttgaatggctcgtctttagtggagtttccactttatcaaagg
aaggattatttagccagtgtacttgagccatacagggcccgagtacaaattgttaatttt
acgagatgttcaaatgagaatataatacgaaaatcattagagcatgccatatcagttggg
tctgaaggaattgttttgaaaaattataattcaaggtacatgataggcagtaggaatgat
agttggatcaaaataaaacctgaatacttggagcaatttggtgaaaatatggatttaatt
gtaataggcagggattctgccaaaaaagactctttttattgtggtctcacggtgctggat
gaagaagaagagaaattagttgaagaaatcgacaaaggcgttgtaaatttggtttctgat
gagtctgactacgaaaatccggagaataataggcacatcaaaaaagtggtatcattttgt
atgattgccaatggcatttctcaaaatgagtacaaagaaatatacaggaaaacgagggga
ttttggaaaaaaactgaggaagttcctcctcctccagaactaatagaatttggtacacag
gtaccaatggaatggattgaaccagaacactcagtagtacttgagataaaagcaagatcg
ttggacaataccgaaagtagctgcaaaaggttcaaagctggatgtacgctttacggaggt
tattgcagacgtattagagatgacgtagactggaaatcctcatttagtctggcggaactt
agaagagatagaagaataaaacactatcctggtacgtcagagaaagatactcttttgaag
tccaagaaaagaaggaaaaaacagcttttgacgcctttaaatcaaaatttgaatccgagg
gatatccagacaacgtcaaaaatatttgatggtcttttcttctacatacttagtgattat
tttgatacaaatgaaaatgtgcgaataagcaaggatgatttacagaaattgttattagaa
aatggaggaaaaattagtcacaatatagtttccaaaagagaaagtaagtctaatctgaga
atactctgtggtaaatacactgcagagtgtaatgtcctgatcaaaagaggctatgacata
ttatctccacaatgggtcatcgactgtgtagaaaacaagaaaatcgttaaaattgaacca
agccattgtttcagtgtatctgatgatttaatggcgcttgcaatgagaagagtagacaaa
tatggtgatagctatgagtcgcttctatcagttagtaggctaagctacattttaagatct
tcaaaagacatttcaccagatttgctgtcacctgcaaatatgagtttagattttgaaaaa
gtcccatattttctattttggaggagaaaggcatttgtgatggagcacaatttcgataaa
agttcaataagggaaactatattgaaaatacaattgtatggtggaaaagtggtgaaaaat
atctctgaatgcaacattgtgattttccctaaagctgaaattactgtaatcagggaaagc
atgaaatttattcgtaatacactagctaaaactgtctcaacttctgtggagttacctatg
ctgccacgaatcgttagcttcgaatggatcgacgcctctatcgagaaaaacgtccaagta
ccagaagaagattacgttccgatgtag

DBGET integrated database retrieval system