KEGG   Kazachstania africana: KAFR_0B00300Help
Entry
KAFR_0B00300      CDS       T02487                                 

Gene name
KAFR0B00300
Definition
hypothetical protein
Orthology
K01196  
glycogen debranching enzyme [EC:2.4.1.25 3.2.1.33]
Organism
kaf  Kazachstania africana
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:kaf00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(68992..73581)
Genome map
AA seq 1529 aa AA seqDB search
MTLNRTLLLRLNDDGEPITSSSYGKGVLTLPSLPLPDSAHAGTPLYTVRLLIAAGSPISR
DGLVWTNCPPDSNTEFQRDKFYKKIIHTSFHRDDQIALDIYRPGPYCFYLSFRNAKDELE
TTRKFYFVALPILKINGNFLQLNSIAMQSVVSKWLGRSVTDDWDKIFQKIASKKYNMIHF
TPLQYRGESDSPYSIYDQMSFDPNFFDSTDDVKKMVEHLHKDYNILSLTDIVFNHTANNS
EWLLDHPDSGYNQSTAPHLTPAIELDESLLEFSHNLKSYGYPTHLNSEDDLFKIMDGIKV
HVLGALKLWEFYAINVKEFLLEIRSHWDSVKTDEEFQKIEDADNITNMAKFICQYATDDT
KLYAISKRNNNSKISIEKLIKILKTNYGNKYNETKCNKILDEINLPLYRSYDDDVNEILE
QLFNRIKYLRLDDNGPKQGEITDKKPLFEPYFTRFTGRDGKKYALANNGWIWDGNPLVDF
ASSTSKAYLRREVIVWGDCVKLRYGNGPEDSPYLWERMSKYIEINAKIFDGFRIDNCHST
PLHVGEYFLDLARKFNPNLYVVAELFSGSESLDCLFVERLGISSLIREAMQCWSEEELSR
LVHRHGGRPIGSYRFVPMHDFPFPADINVDEEYCSYDPNDNSMKCVSEIMIPKILTATPP
HALFMDCTHDNEMPYQKRTVEDTLPNAALVALCSSAIGSVYGYDEIFPYLLDLVKESRVY
EFKECDGIGKVKSLLNEIRENISMKSNDIEDSEMHVHHEGQYITFHRTDVKTGSGWYLIA
RMKFHENEAEQVLPPVILNQSKCELKFSYSLEKIGSVEETQDTQKIKGIPTKLRKLEGFD
IKYEEKSETSTIIIPEDFPTGSIAIFQTQQNGIDSALDHYIRSGALKATKNLTLESLNYI
LFRSESEELDSSNGKVGAYDIPDFGKLVYCGLQGWVSVLQGIMFYNDLAHPLSNNLRAGT
WALDYVVNRLDSYKNEPGVTEVQNWLRSRFERVEKLPSYLRPSYFALIVGILYGCCRLRA
MQLMPHNIGKATVFVQSLAMTSIQMISTLNSTSILPDKNIPAMAAGLPHFSTNYMRCWGR
DVFIAFRGLLLTTGRFDIAKQHILAFAKTLKHGLIPNLLDAGRNPRYNARDAAWFFVQAI
QDYIHIVPNGEDILKESVTRRFPLDDTYVTHDDPRAFSCSTTIEDIIYEILSRHAKGIAY
REANAGPNLDRVMKSEGFNVEVHVDWSTGLIHGGSQSNCGTWMDKMGESEKAGSVGVPGT
PRDGAAIEINGLLKSCLRFVLELNSKNLFKYTEVTKNDNGKITFESWNKLLQENFEKKFY
IPLDPKDDPLYDVDCNIVNRRGIYRDLYKSGKPYEDYQFRANFAIAMTVAPELFTPKYAA
ATLNLADKVLRGPVGMRTLDPSDYNYRPYYINSEDSDDFATSKGRNYHQGPEWVWCTGYF
LRAYLHFNFLTDPRCSNDEKRRPSSFLYQQLYQRLDKHRDWIATSPWAGLTELTNKDGEL
CNDSSPTQAWSSGCLLDLFYDLWSAFEQE
NT seq 4590 nt NT seq  +upstreamnt  +downstreamnt
atgactttgaatagaactttacttttacgtttgaatgatgatggtgagccgataacgagt
tcttcctatggtaaaggtgtgttgactttgccctctttacccctaccggattcagctcat
gctggaacaccattatatactgttagattgctaattgctgctggatctcccatatcgaga
gatggtctggtttggactaattgtccccctgactcgaacactgaatttcaaagggataag
ttctacaagaaaattatccatacaagtttccatagagacgatcaaattgccttagatatc
tatagacctggaccttattgtttctatctatcgtttagaaatgcaaaggacgaattggag
actacgaggaagttctattttgtagcattgcctatcttgaagattaatggtaatttccta
caattgaactcaattgctatgcaaagtgtcgtttctaaatggctgggaagatctgtcact
gatgactgggacaaaatcttccaaaagattgcgtctaagaaatataatatgatccatttt
actccgttacaatatcgtggtgaaagtgattctccttattcaatatatgatcaaatgtca
tttgatcctaatttctttgattccaccgatgatgtcaagaagatggtagaacatttacac
aaggactacaacatcttgtcattgacagatattgtatttaatcatacagccaataattca
gaatggctactagatcaccctgactccggttataatcaatccacagctccacatcttact
ccagccattgaattggatgaatctcttctagaatttagccataatttgaaaagttatggc
tatcccacacacttaaactcagaagatgatcttttcaaaattatggacggtattaaagtt
catgtcctaggtgcactaaagctatgggaattttatgctataaatgtgaaggaatttcta
ttggaaataaggtcacattgggatagcgtaaaaactgatgaagaatttcaaaaaatcgag
gatgcagataatataacgaatatggctaaattcatttgccagtatgcaacggacgataca
aaactatatgctatttctaaaagaaacaataattcaaaaatttctattgaaaaattaatc
aaaattttgaaaacaaattatggcaacaaatataatgaaacgaagtgcaataaaatatta
gatgaaattaatttaccattgtatcgttcttatgatgatgatgtcaacgaaattctagaa
caattattcaatcgtatcaaatatttaaggttagatgacaatggtccgaaacaaggtgaa
attactgataagaaacctttatttgagccatattttacaagattcactggaagagatggt
aaaaaatacgctctggcaaataatggctggatatgggatggtaatccattggttgacttt
gcatcttcgacttcaaaggcatacttacgtagagaggtaattgtatggggtgattgtgtg
aagttacgttacggtaatggtccagaggattcaccttatctatgggaaagaatgtccaag
tatattgaaataaatgcgaagatatttgatggttttagaattgataattgtcattcaacc
ccattgcatgtcggtgagtacttcttagatctagctaggaaatttaaccctaatttatat
gtagtggcagaattgttttctggctctgaatctttggactgtttgtttgtagaaagatta
ggtatttcctccctaatcagggaggcaatgcaatgctggtcagaggaagagctttcaaga
ttagttcatagacatggtggaagaccgatcggttcttacaggtttgtcccaatgcacgat
tttccatttccagctgatattaatgtggatgaagagtattgttcttacgaccctaatgac
aactcgatgaaatgtgtttctgaaattatgatcccaaaaatattaaccgctacccctccg
cacgccctatttatggattgtactcatgataacgaaatgccatatcaaaaaagaactgtt
gaagatactttaccaaacgccgcattggtcgcattatgctcatctgccattggatcagta
tatggttacgacgaaatattcccatatctattggatcttgttaaggaatcaagagtatac
gaatttaaggaatgtgacggcattggtaaagtcaagtctttgcttaatgagattagagaa
aatataagtatgaaatcaaatgatattgaagactcagaaatgcatgtgcaccatgagggg
caatatattactttccaccgtactgatgtaaagacaggttctggttggtatttaattgca
agaatgaaatttcatgaaaatgaggctgagcaagtattacctcctgtcattttaaaccaa
tctaagtgtgagctcaaattttcctacagtctagagaaaattggatcagttgaagaaacc
caggatactcaaaagattaaaggtattccaacaaaattgaggaaattagaaggcttcgac
atcaagtatgaagagaagagtgaaacatccacaattattattccagaggatttcccaaca
ggttctattgcaatatttcagactcagcagaatggtatagactccgcactggatcactat
attagatctggtgcattgaaagcaacaaaaaatttaactcttgaatcgttgaattatatc
ttattccgttctgagagtgaagaactagattcaagtaatggcaaggtgggcgcttatgac
atacctgactttggaaagttagtttactgtggtcttcagggttgggtatcagttttacag
ggaatcatgttttacaatgaccttgctcatccattgagcaataacttacgtgcaggtact
tgggctcttgattatgttgtaaatagattagattcttacaaaaacgaaccaggtgttaca
gaggttcaaaactggctacgttccaggtttgaaagagtcgaaaaactaccaagttatcta
agaccaagttattttgccttaattgttggtattttatatggctgttgccgtttacgtgct
atgcagctaatgccacataatatagggaaagctacagtatttgtccaaagtttagccatg
acttcaattcaaatgatttccacacttaactcaacatctattttgccagacaaaaatatt
ccagctatggcagcaggtttaccacatttcagtactaattatatgagatgttggggtaga
gatgtttttattgcattccgtggtctacttcttacgacaggccggtttgacattgctaaa
caacatattttagcttttgccaaaactttaaagcacggcctaatccccaacttactagac
gcaggtagaaatccaaggtacaatgcacgcgatgctgcatggttttttgtgcaagcaatt
caagattatatccatattgtaccaaacggagaagatatcttaaaagaaagtgttacaaga
agattcccattggacgatacttatgtcacgcatgatgatcccagagcattcagttgctcc
actactatcgaagatattatctatgaaattttgagcagacacgcaaaggggatcgcatac
agggaagctaatgccggcccaaatttagatcgtgttatgaaaagcgaagggttcaatgtt
gaagtgcatgttgactggtcgactggtctaatacatggtggctcacaatccaactgtggt
acttggatggataaaatgggtgaaagcgagaaagccggatccgtaggtgtcccaggcacc
ccaagagatggggctgctatcgaaataaacgggttactgaaaagttgcctaagatttgtt
ctagaactgaattctaaaaacttatttaaatacactgaagtgaccaagaatgataatggt
aagataacttttgaaagctggaataaactattgcaagagaatttcgagaagaagttttat
attccgttagacccaaaagatgaccctctgtatgatgttgattgtaacatagtcaataga
agaggtatttacagagatttgtataaatctggtaaaccatatgaagattatcaattcaga
gcaaattttgccattgcaatgacagtggctccagaattgtttacaccaaagtatgctgcc
gcaacgttgaacctagcagataaagtgttaagagggcctgtcggtatgcgtacattggat
ccgagcgactacaattaccgtccttattacattaacagtgaagattctgatgattttgct
acttcgaaaggtagaaattaccaccagggtcctgaatgggtctggtgtactggctatttc
ttgagggcgtacctccatttcaacttcctgactgatcctcgttgctcaaatgacgaaaaa
cgcaggccttcctcatttttatatcaacaactatatcaaagacttgataaacatagagac
tggatagcaactagcccatgggcaggcttaacagagttaaccaacaaggacggtgaactg
tgtaacgactccagcccgacacaagcttggagctctggctgtttgcttgatttgttttat
gatctttggagcgcctttgaacaagaatga

DBGET integrated database retrieval system