KEGG   Kazachstania africana: KAFR_0B01870Help
Entry
KAFR_0B01870      CDS       T02487                                 

Gene name
KAFR0B01870
Definition
hypothetical protein
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
kaf  Kazachstania africana
Brite
Enzymes [BR:kaf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     KAFR_0B01870 (KAFR0B01870)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(362301..363452)
Genome map
AA seq 383 aa AA seqDB search
MDGFRPETWTISSNEALKISIIDEEDKAIQFKPLFTYPIYGDKEEIFGFKDLVIHLVFDS
ITMKPFLNIKCESILNDDVSIERDVKEKIMKFLPVDDIIYKDEIKWIDCFQDERSRYTLP
DSKFKVDEYELKGEIFGVYKFKLNGYSDNKINKLFKRIQIFTLLFIEAATYINYEDEPNW
ELYVTFNMQNKKFIGFATSYKYWQYEGNETFDKDTRYKYNGKISQFLILPPYQHCGHGSL
LYESLYKGWLKDDGIIEITVEDPNENFDDLRDRNDLKMLSREGFFQELYDKVDEKELLDT
EWIDDKRLKYKIEKRQFDRIIEMILLHMGLVTNFERQVKMRIYLKNYESLMEFEDDEDKK
NAIMQSFDLLKEDYERILSACEF
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atggatggtttcaggccagaaacgtggaccatatcgtcgaatgaggcgttgaagatttct
attatcgatgaagaagataaagctattcaattcaagccacttttcacttatcctatatat
ggagataaagaagagatatttgggtttaaagatctcgtgattcatttagttttcgattca
attactatgaaaccttttttgaatattaaatgtgaatcaattttgaatgatgatgtttca
atagagagagatgttaaagagaagataatgaaatttttacctgtagatgatattatctat
aaggatgaaattaaatggattgactgtttccaggatgagagatctcgttacacactacct
gattccaaattcaaggttgatgagtatgaattaaaaggtgaaatttttggtgtttataaa
ttcaaactgaatggatacagtgataataaaattaataaattattcaaaagaatacaaatt
ttcacactattattcattgaagccgctacatatatcaattatgaagatgagcctaattgg
gaactctacgttacattcaacatgcaaaataaaaaattcatcgggtttgctactagttac
aaatattggcaatatgaaggtaatgaaacatttgataaggatacgagatataaatataat
ggtaagatatcacaatttttaatattaccaccataccaacattgtggacatggatccttg
ctttatgagagtctatataaagggtggcttaaagatgatgggatcattgagatcacagta
gaagaccctaacgaaaattttgatgatttaagagatagaaatgatttgaagatgctatct
cgtgaaggatttttccaggaattgtacgataaggttgacgagaaggaattattggataca
gagtggattgatgacaaacggttgaaatacaagatcgaaaagagacagtttgatagaata
attgagatgattttattacatatggggttagttacaaattttgaaagacaagtgaagatg
aggatatatttgaagaattacgagagtttaatggaatttgaggatgatgaagataagaaa
aatgcaattatgcaatcatttgatcttctaaaggaagattatgaaagaattctatcagcc
tgtgagttctaa

DBGET integrated database retrieval system