KEGG   Kazachstania africana: KAFR_0B01930Help
Entry
KAFR_0B01930      CDS       T02487                                 

Gene name
KAFR0B01930
Definition
hypothetical protein
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
kaf  Kazachstania africana
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:kaf01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:kaf00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(372029..373708)
Genome map
AA seq 559 aa AA seqDB search
MNFPKTSIKVIARQQHMGTRNVNSLNEFVKSQVKEVEEWWKQDRFQRIKRSYSALDVVKH
RGSLGLEDTKYPSSFQAKKLYNLLENKFLARQPVHTLGIIDPVQMTQLAKCEGIPVAYVS
GWACSSTNVSSTNEVAPDFGDYPYDTVPNQVERMFKAQKLHDRKSFLDAVNSGSPLYNYM
KPIIADADMGHGGPTAVMKLAKLFAEKGAAAVHIEDQLMGGKRCGHLGGIVLAPVSTHVT
RLIATRLQWDIMGTENLIIARTDACNSRLIGSSSDPRDHQYIKGTIGSNVTAWVDSLTEM
KSKSIDYKGVSEAEAQWYETHELFTYDEAVERQISAEEYNKYQGLKSKQMEATKKRWLSL
REMRSIAKEASPKKTVIFDWDAPRTNDGYYMFKGCMEAAIERSLIFAPYADMIWLETKTP
NLEEAKEFSRKIHSFCPHIKLVYNLSPSFNWCAYGFSADNLKGFIWDLAKEGFVLQLISL
AGVHVNGVNFWELAKGFEHDGMLAYVDQVQKRKNTNCDLLTHQRWSGVEYVDSILSLVQN
GATSHTRSTGGDSFTEVQF
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgaattttccaaagacatctatcaaagtaatcgcacgtcagcaacatatgggtactaga
aatgtaaatagtctaaatgaatttgtgaaaagccaagtcaaggaggtggaggagtggtgg
aagcaggatagatttcaaagaatcaagagatcgtattctgcactggacgttgttaaacat
cgaggaagtttgggattagaagatactaaatatccttcgtcatttcaggcaaagaagttg
tataatttattggaaaacaagtttcttgcacgtcagcctgtacacacacttggtatcatt
gatcctgttcagatgacacaattagccaaatgtgaaggaattcccgttgcatacgtttct
ggatgggcatgttcatccacaaatgttagttccacaaatgaagtcgcacccgactttggt
gactacccatatgatactgttccaaatcaagtggaaagaatgtttaaggcccaaaaattg
cacgatcggaagtcgtttttggacgctgttaattccggttctcctttgtataattatatg
aaacctatcattgctgatgctgatatgggacatggtggtcctactgctgtaatgaaattg
gcgaaacttttcgctgagaaaggagcagccgcagttcatattgaagatcaattaatggga
ggtaaacgttgcggtcatttaggaggaatagtactggcaccggtgagtacgcatgtgaca
aggttgatagccactaggctgcaatgggatataatgggaacagaaaatttaatcatagca
agaacagatgcatgcaacagtaggctaatcggcagtagttctgacccaagagatcatcaa
tatattaaggggacaattgggtccaatgtcactgcatgggttgattccttaacagagatg
aaatctaaatctattgattataaaggagttagcgaagctgaagcacaatggtatgaaacg
catgagcttttcacttatgacgaagctgttgaaaggcaaatttcagctgaagagtacaac
aagtaccaaggtttaaaatcaaaacaaatggaagctacgaaaaaaaggtggttaagtcta
agagaaatgaggagtatcgctaaagaggcctctccaaaaaagacagtaatttttgattgg
gatgctcctagaactaatgatggttattatatgttcaaaggttgtatggaagctgcaatt
gagcggtctcttatttttgcaccttatgcagatatgatttggctcgaaacaaaaacacca
aacttggaagaagcaaaggagttttctagaaagattcattcattttgtccacacattaag
ttagtttacaatttatctccaagttttaattggtgtgcatacggcttctcagcagataac
cttaaaggcttcatttgggatttagcgaaagagggctttgtactacaattaatatcgtta
gcaggcgtgcatgttaacggtgtaaacttctgggaacttgccaaaggatttgagcatgac
ggtatgttagcatatgtcgaccaggttcaaaaaaggaaaaatactaattgcgacttgctc
acacatcaacgctggtcaggtgtggaatacgttgactcgatattgagccttgttcagaat
ggtgcaacttcacataccaggagtacaggaggcgacagttttaccgaagttcaattctaa

DBGET integrated database retrieval system