KEGG   Kazachstania africana: KAFR_0B02730Help
Entry
KAFR_0B02730      CDS       T02487                                 

Gene name
KAFR0B02730
Definition
hypothetical protein
Orthology
K00814  
alanine transaminase [EC:2.6.1.2]
Organism
kaf  Kazachstania africana
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:kaf01200]
Metabolism; Overview; 2-Oxocarboxylic acid metabolism [PATH:kaf01210]
Metabolism; Overview; Biosynthesis of amino acids [PATH:kaf01230]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:kaf00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(558858..560477)
Genome map
AA seq 539 aa AA seqDB search
MTTLSISRRSSSLNAFFTKMSPSVTILPPNTYSYYSTKSFSNPKPRKHNLNFKPAGQLTI
GDLNENVLKAKYAVRGKIPTRAEELKRQLAEKPNSLPFDKIINANIGNPQQLQQQPLSFY
RQVLSLLQYPTLLHAIETKPGSSAVYKKDAILRAKKILKDIGGSVGAYSESQGVYGIRRT
VANFITERDGGEPAYPEDIFLTAGASAAVNYLLSILCKGEKTGVLIPIPQYPLYTATLAL
NNSHALPYFLDEMNGWSINPIEIENVIKKAVQDNIKPDVLVVINPGNPTGAVLSKEAIVS
ILEIAAKYGIVVIADEVYQENIFDGMKFHSVKGVLRRLQREIPGKFDNVQLASLHSTSKG
VSGECGQRGGYMEIIGFTHEVRQVILKLASISLCPVVTGQALVDLMVSPPKRGEESFALD
QAQRKTIHSQLSQRAELLWKTFNSLDGIECQKPNGAMYLFPKLNLPYRAIQEAQRLELSP
DEFYCKELLEHTGICTVPGSGFGQVAGTYHLRTTFLAPGIEWIDSWKQFHIEFMEKYNS
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgaccacactttcaatatcaagacgctcttcaagtcttaacgcttttttcactaaaatg
tcaccatcagttaccattctaccacccaatacatactcttactattctactaaatcattt
tctaatccaaaaccaagaaagcataacttgaatttcaagcctgccggtcaattaactatc
ggtgacttgaatgaaaacgttctaaaagcaaaatatgccgttagaggtaagatacccacg
agagcagaagaattgaaaagacaactagcagaaaagccaaatagtctaccttttgataaa
attattaacgcgaatattggtaatcctcaacagttacaacagcagcctttaagtttctat
agacaagtgctttcacttttgcaatacccgactttacttcatgccattgaaaccaagccg
ggatcatctgctgtgtataagaaagacgctatcctaagagccaaaaaaattctaaaggat
attggtggatcagtgggtgcatattccgaatctcaaggtgtatatgggataaggagaacc
gttgcaaactttattacagaaagagatggcggtgagccagcttatccagaggatatcttt
ttaaccgcaggtgcatctgctgcagtaaactacttactctccatcctctgtaaaggtgaa
aaaactggtgtcttgattcctatcccacagtatcctctatatactgcaactttggcctta
aataattcgcatgctttaccatatttcctagatgaaatgaatgggtggtcaataaatccc
atagaaattgagaatgtcattaagaaagccgtccaagataatattaagcctgacgttctt
gttgtaattaatcccgggaaccccacaggtgctgtcttatctaaagaagccattgtaagt
atcttggaaattgcggccaagtacggtatcgtagtcattgccgatgaagtgtaccaagaa
aatatatttgatggaatgaagttccattcagtaaaaggagttttaagacgtttacaacgt
gaaatcccgggtaaatttgataatgtacaattagcatcattacattctacttctaaaggt
gtatccggtgaatgtggccaaagaggtggttacatggagataatcggttttacacacgag
gttagacaagtaattttgaaattagcctctatctcactttgtcctgtcgttactggtcaa
gcattagtcgacttaatggtttctcctccaaagagaggtgaagaatcatttgcactagac
caagctcaaagaaaaacgattcatagtcaattgtcacagagagccgagttactttggaaa
acattcaattctttagatggtattgaatgccaaaaaccaaatggtgctatgtatcttttc
cccaaattgaacttaccttaccgtgcaattcaagaagcgcaacgtctagaactatctcct
gacgaattctattgtaaggaattactagagcatacaggtatttgtaccgtaccggggtct
ggatttggacaagtcgcaggtacgtaccatttgagaacaactttcttagcaccaggaatt
gaatggatcgatagttggaagcaatttcacatagaattcatggaaaaatacaactcttaa

DBGET integrated database retrieval system