KEGG   Kazachstania africana: KAFR_0B02980Help
Entry
KAFR_0B02980      CDS       T02487                                 

Gene name
KAFR0B02980
Definition
(RefSeq) hypothetical protein
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
kaf  Kazachstania africana
Pathway
kaf04011  MAPK signaling pathway - yeast
kaf04139  Mitophagy - yeast
kaf04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:kaf00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    KAFR_0B02980 (KAFR0B02980)
 Cellular Processes
  Transport and catabolism
   04139 Mitophagy - yeast
    KAFR_0B02980 (KAFR0B02980)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    KAFR_0B02980 (KAFR0B02980)
Enzymes [BR:kaf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     KAFR_0B02980 (KAFR0B02980)
Protein kinases [BR:kaf01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   KAFR_0B02980 (KAFR0B02980)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase Kdo APH Ribosomal_60s Kinase-like LEA_6 FTA2 RIO1
Motif
Other DBs
NCBI-GeneID: 13882975
NCBI-ProteinID: XP_003955729
UniProt: H2AQE4
Position
2:623470..624804
Genome map
AA seq 444 aa AA seqDB search
MASHEEFIRTQIFGTVFEITNRYADLNPVGMGAFGLVCSATDTLTQQPVAIKKIMKPFST
AVLAKRTYRELKLLKHLRHENLICLQDIFLSPLEDIYFVTELQGTDLHRLLETRPLEKQF
VQYFLYQILRGLKYVHSAGVIHRDLKPSNILINENCDLKICDFGLARIQDPQMTGYVSTR
YYRAPEIMLTWQKYNVEVDIWSAGCIFAEMIEGKPLFPGKDHVHQFSIITDLLGSPPEDV
INTICSENTLKFVTSLPHRDPIPFSERFKNVEPDTVDLLAKMLVFEPKKRITAAEALAHP
YLAPYHDPTDEPVADAKFDWHFNDADLPVDTWRVMMYSEILDFHKIGGTDGQIDTNATFD
DQVAAATAAAAEAQAQAQAQAKAAQAKAAQAKGTSNDISNKLNDNVAVDNKDINTRDTAI
NGDVSDDISNYANQAVLYANEFQQ
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atggcttcacatgaggaattcattagaactcaaatatttggaacagtatttgaaattaca
aatagatatgccgatttaaacccagtaggaatgggggccttcggtttggtttgttccgct
acagatactttaactcaacaaccagtcgctatcaaaaagataatgaaacctttctcaacc
gctgtcctcgcaaagagaacttacagagaattaaaattattaaaacatttaagacatgaa
aatctaatctgtttacaagatatctttctatcgcctttagaagatatttatttcgtaaca
gaattacaaggtactgatcttcataggttattagaaacaagacctttagaaaaacaattc
gttcaatatttcctttatcaaattttaaggggtttaaaatacgttcattctgctggggtc
atccatagagatctaaaaccaagtaatatcttaattaatgaaaattgtgacttgaaaatt
tgtgatttcggtctagcaagaattcaggatcctcaaatgacaggttacgtttccactcgt
tactacagagctccagaaattatgttaacttggcaaaaatataacgtagaagtggatatt
tggtctgcgggttgtatctttgcagaaatgattgaaggtaagcctctattcccaggaaaa
gatcacgttcatcaattttcaatcataacagatttgttaggttctcctcctgaagatgtg
ataaatacaatttgttcggaaaatactttaaaattcgtgacgtctttgcctcatagagat
ccaatcccattttctgagagatttaaaaacgtagaaccagatactgtagatttattagct
aagatgttagtttttgaacccaaaaaaagaatcacagcggcagaagccctagcacatcca
tacttggcgccttatcatgatccaacggatgaaccagttgctgatgctaaatttgactgg
catttcaacgatgcagatttacccgtcgatacctggagagtgatgatgtattctgagata
ttggatttccataaaataggcggaactgacggtcaaatcgatactaatgctacattcgat
gatcaggttgctgctgctacagctgctgctgcagaagcacaagcgcaagcacaggcacaa
gcaaaagcggcacaagcaaaagcggcacaagcaaaaggtacttcaaatgatatctcaaac
aaattaaatgataatgttgcagtggacaacaaagatattaacacacgtgacacagcgatc
aatggtgatgtcagtgatgatataagtaattatgccaatcaagccgtcttgtatgccaac
gaatttcaacagtaa

DBGET integrated database retrieval system