KEGG   Kazachstania africana: KAFR_0B04450Help
Entry
KAFR_0B04450      CDS       T02487                                 

Gene name
KAFR0B04450
Definition
hypothetical protein
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
kaf  Kazachstania africana
Brite
Enzymes [BR:kaf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     KAFR_0B04450 (KAFR0B04450)
Transcription machinery [BR:kaf03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     KAFR_0B04450 (KAFR0B04450)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(924637..926007)
Genome map
AA seq 456 aa AA seqDB search
MVSKRKAEQHNVDSLTSEDAHENKKMKLDDKPTEDTDTANKNGDYNEEDENKTQGENSGE
VDENADDNDMEETENDKVPETEIIDDSDRGIVKFEFDNVEYKFKERASVIEENEGKIEFR
VVNNDNTKENLMVLTGLKNIFQKQLPKMPKEYIARLVYDRSHLSMAVIRKPLTVVGGITY
KPFDRREFAEIVFCAISSTEQVRGYGAHLMNHLKDYVKNTSNIKYFLTYADNYAIGYFKK
QGFTKEITLDKKIWMGYIKDYEGGTLMQCSMLPRIRYLDAAKILLLQEAALRRKVRTISK
SHIVRPGLDQFRDLDNIKPIDPMTIPGLKEAGWTPEMDELAQRPKRGAHYAVMQNILTEL
QNHAAAWPFLQPVNREEVPDYYDFIKEPMDLSTMEIKLENNKYQKMEEFIRDVKLICSNC
RLYNGENTSYFKYANRLEKFFVGKMKEIPEYSHLVD
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atggtttcaaaacgtaaggcagagcaacacaatgtcgactctttgacatctgaagatgca
catgaaaataaaaaaatgaaattagatgataaaccgacagaagatacagatacggcaaac
aaaaatggagattataatgaagaagatgagaacaaaactcaaggcgaaaattccggcgag
gtagatgaaaatgcagacgataatgacatggaggaaacagagaatgataaagtacccgaa
acagagatcatagatgatagcgatcgtggaattgttaagttcgagtttgataatgttgaa
tacaagttcaaggaaagagccagtgttattgaagaaaatgagggtaaaatagagttcaga
gttgttaataatgataatacgaaagaaaacttaatggttctgacgggtttaaagaatatt
ttccagaaacaactaccgaaaatgcctaaagaatatatagccagattagtctacgatcga
agtcatctttctatggcagttatccgaaagccattgacagttgttggtggaattacatat
aaaccatttgacaggagagaatttgcagaaattgtgttttgtgcaatcagttctactgaa
caagttcgtggttatggtgctcatctaatgaaccatttaaaagattatgtgaagaacacg
tctaatatcaaatattttctaacctacgctgataattatgcaatcggttattttaagaaa
caaggttttacaaaggaaattacgttagataaaaaaatatggatgggttatattaaggat
tatgagggagggacactaatgcaatgttcaatgttgcccagaatacgatatttagatgca
gccaagattctactattgcaagaagcagccttaagaagaaaagttagaacaatatcaaaa
tcacatatagtaagaccaggtctagatcagtttcgagatttagataatataaagccaatt
gaccctatgacgatacctggattgaaagaagctggctggacgccagaaatggatgaatta
gcccaaagaccgaagagaggtgcccattatgcagtaatgcagaatattttaactgagcta
caaaatcatgctgcagcttggccctttttacagcctgtcaacagagaagaggttcctgac
tactacgatttcatcaaggaaccaatggatttgagtacaatggaaatcaaattagagaat
aataaatatcaaaaaatggaggaatttatacgcgacgttaagctaatttgtagcaattgt
aggctatacaatggtgaaaacacatcctatttcaagtatgccaatagactagaaaaattc
ttcgtaggcaaaatgaaggaaattccagaatattcacatttggttgattaa

DBGET integrated database retrieval system