KEGG   Kazachstania africana: KAFR_0B05520Help
Entry
KAFR_0B05520      CDS       T02487                                 

Gene name
KAFR0B05520
Definition
hypothetical protein
Orthology
K00814  
alanine transaminase [EC:2.6.1.2]
Organism
kaf  Kazachstania africana
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:kaf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    KAFR_0B05520 (KAFR0B05520)
   01210 2-Oxocarboxylic acid metabolism
    KAFR_0B05520 (KAFR0B05520)
   01230 Biosynthesis of amino acids
    KAFR_0B05520 (KAFR0B05520)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    KAFR_0B05520 (KAFR0B05520)
Enzymes [BR:kaf01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     KAFR_0B05520 (KAFR0B05520)
Amino acid related enzymes [BR:kaf01007]
 Aminotransferase (transaminase)
  Class I
   KAFR_0B05520 (KAFR0B05520)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:1130297..1131829
Genome map
AA seq 510 aa AA seqDB search
MPPITSSTSGTSNTPTSDSNTHDFEPAPKISVADLNQKIINAEYAVRGSIAMRAEELEFE
LYHKTQPHSFPFERIIYANIGNPQQLDQKPLTFSRQVMSILEYPGLLKFKDVLLSQGIYK
KDALERAELLQSQIGASVGAYSLAQGVYGIRETTARFISKRDNCEAASADDIFLTDGASK
AVTYLMMALCQNEHTGILIPIPQYPLYTASICIHNAKMLPYYLDEESGWSTKVEEIENSV
INAIENGIKPSAMVVINPGNPTGAVLSVDVIQRIITVAAKYGIVLIADEVYQDNIFNGEF
HSMKKILRQLQKKYPGKYDNVQLASLHSTSKGVSGECGQRGGYMEIVGFSDEVRHLLLKL
ASINICSVVTGQALVDLMVDPPHVGDESYEKDQEERNEIHSTLKKRADKLYDTFSNLEGI
ECQKPQGAMYLFPRLILPDRAIEEAKKLQMEADEFYCHKLLENTGICTVPGSGFGQREGT
YHVRTTFLSPGTEWIDDWKKFHEKFMKEYQ
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgcccccaataaccagctcaacttcaggcacctcaaacacgccaacaagtgattctaat
actcatgacttcgaaccagcgcctaaaatatccgtagctgatctgaaccaaaagataata
aatgctgagtatgccgttagaggatcgatcgcgatgagagcggaggagttagaatttgaa
ttgtatcacaagactcagccccacagttttccatttgagagaattatttacgcaaatata
ggtaaccctcaacaacttgatcagaaaccactaactttttcgagacaagtcatgtcgatt
ttggaatatcctgggctattgaaattcaaggatgttttactatctcaaggtatctataag
aaggacgctttggagagagcagaattattacaatctcaaattggagcttcagttggtgca
tattcattagcacaaggtgtctatggcattagagaaacaacggcaaggtttatttctaaa
agagataattgcgaagctgcatccgcggatgatatatttttaacagatggagcttcaaaa
gctgttacttaccttatgatggcgctatgtcagaatgagcatactggtattttgattcct
atcccgcaatatcccttatacacggcatctatatgcattcataatgcaaagatgttacca
tattacctagatgaagaatctggctggtccacaaaagttgaggaaatcgaaaactccgtc
attaatgcaattgagaatggtatcaaaccctccgctatggtggttataaatcctggaaac
cctacgggagcagtcttatccgtcgatgtgattcaaaggattatcactgtggcagctaag
tatggaattgtattgattgctgatgaagtgtatcaagataatattttcaacggagaattc
cactctatgaaaaaaatacttagacaattacaaaagaaatatccaggaaaatatgataac
gttcaattagcttcacttcattccacgtcaaaaggagtatcaggagaatgtggacagaga
ggtggctacatggaaattgttggattttctgatgaagtgaggcatttgcttttaaaattg
gcttccattaacatatgctctgttgtcacaggccaggcacttgtagatttaatggttgat
ccaccacatgttggtgatgaatcctatgaaaaggatcaagaagaaagaaatgaaattcat
tctacactgaaaaagagagcagataaattatatgacactttttctaatctagagggtatt
gaatgccaaaaaccacaaggtgctatgtatcttttccccagattaattcttcccgatagg
gcaattgaagaggccaagaaactgcagatggaagcggatgaattttactgccataaattg
ctagaaaatacaggaatatgcacagtcccaggttcaggattcggccaaagagagggcacc
tatcatgtaagaaccacctttttgtcaccaggcaccgaatggattgatgactggaagaaa
ttccacgaaaaatttatgaaagaatatcaataa

DBGET integrated database retrieval system