KEGG   Kazachstania africana: KAFR_0B06460Help
Entry
KAFR_0B06460      CDS       T02487                                 

Gene name
KAFR0B06460
Definition
hypothetical protein
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
kaf  Kazachstania africana
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:kaf00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    KAFR_0B06460 (KAFR0B06460)
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    KAFR_0B06460 (KAFR0B06460)
Enzymes [BR:kaf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     KAFR_0B06460 (KAFR0B06460)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(1339054..1341780)
Genome map
AA seq 908 aa AA seqDB search
MDSSSKNLDTSVVPHLHEVHPSKVIEGSRGYGRTTLNTSAAKCGAQTAKNVRKILSGTSE
VYPSTNTIGPPVKTPIVKENKNRSYLQSFPIIGPSTYPYSLSEILKYASESTSKITLIQD
EGLLKMCKLLRKEGVFLIKITRNKRRKYLFKLDDDNSVVTWRSDKKKKLELDSIKDIRVG
TMANNYFDEHDMSPALNNLWITLIYSVGRKLKVLHLLAPDSNAHNIFFNCIYGLVTVRRR
IMESLLLPDNEEFARVHWRLAVSELEEDEGKDVLTFDQIRKLCSNFQIYCTSEHLLRLFK
NADVNRNQLLNFKEFQAFVKSLKRRKEIDTIWNSLIKDQEFLDFDSFCNFLVDIQGEIHL
KRDEIKTIFRDFKETERIGMTKGDFVRYLNSRPYLTSAKERNIDYTRPLNHYFIASSHNT
YLLGKQYGETPSVEGYIQVLQQGCRSVEIDIWDDNSGPVVCHGILTPAIPLANVIKVIRK
YAFISSYMPLIISLEMHCNKENQKAVAIILKDLLGDLLYTNESTELGDMPSPMELRHKIV
LKVKKSKSYFQSSNNSSFSSSSSYYSSSYFSSNDSEIDSTNMIAISSTSKPKGLRRLKRI
GSLKKRADVIPVLLDISSIYGLKFRNFSLPESKTVNHCFSLNEKKVDFMIKDSVLSCSLN
KHNRKYLMRVYPHVLRYKSSNFNPIKYWKLGVQMVATNWQTNDIGQQLNLAMFQLEDTRN
SMMNSGYILKPRNLIDSVSKIKDITSIYNSDDRRPVKLRMRVVSGQLLPHVTKLSINKNE
IKGNDCGSHTFAPYVVARVIDDEESIVKPLFDVRNGTQLGANEIMTSTCQGNGFNPIFEM
EFQIILRNLDFSFLQLVVKTNESSIGTAYLKLEYLKKGYRHIPLFNSEGQRYTFSTLFIY
SELTEIDY
NT seq 2727 nt NT seq  +upstreamnt  +downstreamnt
atggattctagttcgaagaatctggatacttcagtggtaccgcatttgcacgaagtacac
ccttccaaggttatcgagggctctcgaggatatggaagaactacactcaatacatcagca
gcaaagtgtggagctcaaacagccaagaatgtcaggaagattctaagtggaacaagcgaa
gtttatccaagtactaatacgattggtccgcctgtcaagactcccattgtcaaagaaaac
aaaaatagaagttatctgcagtcatttccgattattgggccttcgacgtatccatattca
ctgagtgagatacttaagtatgcttctgagtctacaagcaaaataactttgatacaagat
gaaggactgttaaaaatgtgcaaactccttagaaaggaaggagtttttttgattaagatt
accagaaacaaacgtaggaagtacttattcaaactggatgacgataatagtgtggttaca
tggcgatctgataaaaagaaaaagttggaactggattccataaaggatattcgagtaggg
actatggctaataactattttgatgaacatgatatgtctcctgcgttaaataatctttgg
atcacacttatttattcagttgggagaaagctcaaggtgttacatttgttggctcctgat
agcaatgctcataatattttctttaattgcatctatggtttggtcactgtaaggagacgt
ataatggaaagcttattgctgccagataatgaagaattcgctcgagtccattggaggcta
gctgtatcagaattagaggaagatgaaggtaaagatgttttgacatttgaccaaatacga
aaactttgcagtaatttccaaatatattgcacttcagaacatcttttgagattattcaag
aacgctgatgttaatcgaaaccagttattgaacttcaaggagtttcaggcttttgttaaa
tcgctaaagcgcaggaaagaaattgacacgatatggaactccctaatcaaagatcaagag
tttcttgatttcgacagtttttgcaattttttagttgatatacaaggtgaaatacactta
aaaagggatgagataaagactatattccgagatttcaaagaaactgaacgtattggaatg
acaaagggagatttcgtgaggtatttgaattcacgtccctatttaaccagcgcaaaggaa
agaaacatagattataccaggccattgaatcactattttattgcatcttcccataacacc
tatctactgggaaagcagtatggtgagacgccttctgtggaaggctacatccaagttttg
cagcaaggttgtaggtctgttgaaatcgatatttgggatgataattcaggcccggttgtt
tgtcatggtatattgacgcctgcaatcccgttagctaatgttataaaggtcattagaaag
tatgctttcatttcttcttacatgccactgataatatctttagaaatgcactgcaataaa
gaaaaccaaaaagcagttgcaatcattctaaaagatcttcttggggatttactttatact
aatgaaagtactgaactaggagatatgccgtctccaatggaattaagacacaaaatcgta
ttaaaagtgaagaaatccaaaagttattttcaatcctctaataactcatcattttcttca
tcatcgtcatattattcttcgtcttatttttcttctaatgattcagaaatagattcgact
aatatgattgcaatatcatctacaagtaaacccaagggtttgaggaggctcaaaagaatt
ggtagtcttaaaaaacgggcggatgttattccagtattattggacatttcaagtatttat
gggctgaaatttagaaatttttcattacctgaatcgaaaaccgtaaatcattgcttttcc
ttgaatgaaaagaaagttgactttatgatcaaagattctgtgctttcatgttccttaaac
aaacacaatcgaaaatatcttatgcgagtctatccacatgtcttgagatacaaatcatca
aacttcaacccaattaagtattggaaattgggcgttcaaatggttgccacaaactggcag
acaaatgatatcggacaacaactaaatctggcaatgttccaactagaagatactaggaac
tcaatgatgaattctggatatattttgaagcctagaaatctgattgacagcgtaagcaag
attaaagatattacatcaatatacaacagtgatgatagaagaccggtcaagttgagaatg
agggtagtttctgggcaattgcttccacatgtgacaaaacttagtattaacaagaatgaa
atcaagggaaatgattgcggctcacacacttttgctccatatgttgtggccagggtgatc
gatgatgaggaatccattgtgaaacccttattcgacgttcgaaatggaactcaacttgga
gctaacgaaataatgacgagtacctgtcaaggaaatgggtttaatcctattttcgaaatg
gaatttcaaataattttaaggaacctagatttctcgttcctccaattggtggttaaaact
aatgaaagttcgattggtacagcttatttgaaattagaatatctcaaaaaagggtataga
catattcctttgttcaatagcgagggtcaaagatatactttctcaacattattcatttac
tctgagctgactgaaatagattactga

DBGET integrated database retrieval system