KEGG   Kazachstania africana: KAFR_0C02840Help
Entry
KAFR_0C02840      CDS       T02487                                 

Gene name
KAFR0C02840
Definition
(RefSeq) hypothetical protein
Organism
kaf  Kazachstania africana
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:559821..560873
Genome map
AA seq 350 aa AA seqDB search
MGKKIVFNISSDFQLKSLLGEGAYGVVCSATHKPTGEIVAIKKIEPFDKPLFALRTLREI
KILKHFQHENIISIFDIQKPDSFENFNEVYIIQELMQTDLHRVISTQELSDDHIQYFIYQ
TLRAVKILHGSNVIHRDLKPSNLLINSNCDLKVCDFGLARIIDEHNNSDAYSKQNGMTEY
VATRWYRAPEVMLTAAKYSKAMDVWSCGCILAELFLKRPLFPGKDYRHQLMLIFGLIGTP
TGEDLQCIESKRAREYIMTVPRYDPVPWEKVFAHVNPLGVDLLKKMLVFDPSKRITAAEA
LRHPYLKTYHDPNDEPEGAPISPTFFEFDHFKDVLTTKDLKKLLWNEIFC
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaaaagatagtgtttaacatatcgagcgacttccaattgaagtcgctactcgga
gaaggtgcatacggagtggtatgttctgcaactcataaacccaccggtgaaattgttgcc
attaagaaaattgaaccatttgataaaccattatttgccttaagaacacttcgtgaaata
aaaatcttgaaacattttcagcatgagaatattatatcgatttttgacattcaaaaaccg
gattcctttgagaatttcaatgaagtttatatcattcaagagttaatgcaaacggatttg
caccgtgttatctctacacaagaattgagtgacgatcatatacagtatttcatctatcaa
acattgagagctgtcaaaattttacatggttctaacgtaattcatagagacttgaagccc
tctaatttactgataaactccaattgtgatttgaaagtttgtgatttcggattagctaga
attattgatgaacataacaatagtgacgcatattcaaaacagaatggtatgactgaatac
gttgcgacaagatggtatagagcaccagaagtcatgctaacggcggccaaatactcaaaa
gccatggatgtatggtcatgcggttgcattttggcagaattatttcttaagagaccattg
ttcccaggtaaagattataggcatcaattaatgctcatattcggattaatcggtacgcca
acaggcgaagacttacaatgcattgagagtaaaagagcaagagaatatataatgaccgta
ccaagatatgatcctgtgccgtgggagaaagtttttgcacatgtcaatccattaggcgtt
gatcttttgaaaaaaatgctagtatttgatcctagtaaaagaatcacagcagcggaggca
ttgagacatccatatttgaagacataccacgatccaaatgatgaaccagaaggtgcacca
atttcgcctactttcttcgagttcgatcatttcaaagatgttcttactacaaaggacttg
aaaaagttgctgtggaacgaaatattctgctaa

DBGET integrated database retrieval system