KEGG   Kazachstania africana: KAFR_0C02840Help
Entry
KAFR_0C02840      CDS       T02487                                 

Gene name
KAFR0C02840
Definition
(RefSeq) hypothetical protein
Organism
kaf  Kazachstania africana
Pathway
MAPK signaling pathway - yeast
AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:kaf00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    KAFR_0C02840 (KAFR0C02840)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    KAFR_0C02840 (KAFR0C02840)
Enzymes [BR:kaf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     KAFR_0C02840 (KAFR0C02840)
Protein kinases [BR:kaf01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   KAFR_0C02840 (KAFR0C02840)
Chromosome [BR:kaf03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     KAFR_0C02840 (KAFR0C02840)
Exosome [BR:kaf04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   KAFR_0C02840 (KAFR0C02840)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:559821..560873
Genome map
AA seq 350 aa AA seqDB search
MGKKIVFNISSDFQLKSLLGEGAYGVVCSATHKPTGEIVAIKKIEPFDKPLFALRTLREI
KILKHFQHENIISIFDIQKPDSFENFNEVYIIQELMQTDLHRVISTQELSDDHIQYFIYQ
TLRAVKILHGSNVIHRDLKPSNLLINSNCDLKVCDFGLARIIDEHNNSDAYSKQNGMTEY
VATRWYRAPEVMLTAAKYSKAMDVWSCGCILAELFLKRPLFPGKDYRHQLMLIFGLIGTP
TGEDLQCIESKRAREYIMTVPRYDPVPWEKVFAHVNPLGVDLLKKMLVFDPSKRITAAEA
LRHPYLKTYHDPNDEPEGAPISPTFFEFDHFKDVLTTKDLKKLLWNEIFC
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaaaagatagtgtttaacatatcgagcgacttccaattgaagtcgctactcgga
gaaggtgcatacggagtggtatgttctgcaactcataaacccaccggtgaaattgttgcc
attaagaaaattgaaccatttgataaaccattatttgccttaagaacacttcgtgaaata
aaaatcttgaaacattttcagcatgagaatattatatcgatttttgacattcaaaaaccg
gattcctttgagaatttcaatgaagtttatatcattcaagagttaatgcaaacggatttg
caccgtgttatctctacacaagaattgagtgacgatcatatacagtatttcatctatcaa
acattgagagctgtcaaaattttacatggttctaacgtaattcatagagacttgaagccc
tctaatttactgataaactccaattgtgatttgaaagtttgtgatttcggattagctaga
attattgatgaacataacaatagtgacgcatattcaaaacagaatggtatgactgaatac
gttgcgacaagatggtatagagcaccagaagtcatgctaacggcggccaaatactcaaaa
gccatggatgtatggtcatgcggttgcattttggcagaattatttcttaagagaccattg
ttcccaggtaaagattataggcatcaattaatgctcatattcggattaatcggtacgcca
acaggcgaagacttacaatgcattgagagtaaaagagcaagagaatatataatgaccgta
ccaagatatgatcctgtgccgtgggagaaagtttttgcacatgtcaatccattaggcgtt
gatcttttgaaaaaaatgctagtatttgatcctagtaaaagaatcacagcagcggaggca
ttgagacatccatatttgaagacataccacgatccaaatgatgaaccagaaggtgcacca
atttcgcctactttcttcgagttcgatcatttcaaagatgttcttactacaaaggacttg
aaaaagttgctgtggaacgaaatattctgctaa

DBGET integrated database retrieval system