KEGG   Kazachstania africana: KAFR_0C02920Help
Entry
KAFR_0C02920      CDS       T02487                                 

Gene name
KAFR0C02920
Definition
hypothetical protein
Orthology
K11483  
histone deacetylase HOS2 [EC:3.5.1.98]
Organism
kaf  Kazachstania africana
Brite
Enzymes [BR:kaf01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     KAFR_0C02920 (KAFR0C02920)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:complement(584668..586029)
Genome map
AA seq 453 aa AA seqDB search
MSRTLTYDRHTEENKPQFERVFGSSYTPRVSYHFNPKVSNYHYGVNHPMKPFRLMLTDHL
VSSYGLHKIMDLYETREATKEEMSQFHSSDYLDFLEKISPDTLNKIPRGTLEKFNIGSDC
PIFENIYDYSTLYTGASLDASRKLINGQSEIAINWSGGLHHAKKNNPSGFCYINDIVLSI
LNLLRYHPRVLYIDIDLHHGDGVQEAFYTTDRVFTISFHKYNGEFFPGTGNYDEIGCSGG
KHFAMNVPLNDGIDDDSYIKLFKSIIDPLITSYQPTVIIQQCGADSLGHDRLGCFNLNIK
AHGECVKFVSSFGIPMLVVGGGGYTPRNVSRLWAYETGILNNVLLPKELPEELPFRENFG
PDYSLYPTLDDLYENKNSKRHLEDLRIRSLEQIRFLQGAPSVRMDSELIPTEDISGLTQE
EEEAINELNEEGKFDAWRLNKIERENAQLGEFI
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaggactttgacgtacgatagacatactgaagagaacaaaccacagtttgagcgc
gtttttggctcgagctatacgccgagagtgtcgtaccatttcaatccaaaggtgtcgaat
taccattatggtgtgaatcatcccatgaaaccgttcagattgatgctgacagatcatttg
gtatcgtcctatggtttgcacaagatcatggatctgtatgagacaagagaagctacaaaa
gaagaaatgtcacaatttcattcatctgattatcttgattttctagagaaaattagtcca
gatactttgaataagataccaagaggtacgttagaaaaatttaatataggttcagattgt
cccattttcgaaaatatttacgattattctactttatacacaggtgcatctctcgatgca
tctcgcaagttaattaatggtcaatctgaaatcgcaataaattggtcaggtggactacat
catgcaaagaaaaataatccttcagggttctgttacattaacgatattgtattatcaatc
ttaaatttgttacgttatcatccaagagtactttatatcgacattgacttacatcatggt
gatggtgtccaagaagcattttacaccacagatcgagtctttactatatcatttcataag
tataatggtgagtttttccccggtacggggaattatgatgaaattggttgttctggaggg
aaacatttcgcaatgaatgtacctttaaatgatggtattgatgacgattcttatatcaaa
ctatttaaatccattatagatccattaatcacttcatatcaaccaactgtaatcatacaa
caatgtggtgcagattccttaggtcatgatagactaggatgtttcaacctgaatataaaa
gctcatggtgaatgtgtaaaatttgttagctcctttggcatcccaatgttagttgtagga
ggcggtggttacactccaagaaatgtttctagactatgggcctatgaaactggtatactc
aacaacgtcttgctaccaaaggaattgcctgaagaattgccatttagagaaaactttgga
ccagattattcattatatccaactttagatgatctgtacgaaaataaaaatagtaaaaga
catttggaagatcttagaatacgaagtcttgaacaaatcagatttttacaaggtgcccca
agtgttagaatggatagtgaattaattccaacggaggatatctctggactaacacaagaa
gaagaggaagctattaacgaactgaatgaagaggggaaattcgatgcttggagattgaat
aaaattgagagagaaaatgcgcaactcggtgagttcatttga

DBGET integrated database retrieval system