KEGG   Kazachstania africana: KAFR_0C04470Help
Entry
KAFR_0C04470      CDS       T02487                                 

Gene name
KAFR0C04470
Definition
hypothetical protein
Orthology
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
kaf  Kazachstania africana
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:kaf00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    KAFR_0C04470 (KAFR0C04470)
Enzymes [BR:kaf01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     KAFR_0C04470 (KAFR0C04470)
Glycosyltransferases [BR:kaf01003]
 Polysaccharide
  Storage polysaccharide
   KAFR_0C04470 (KAFR0C04470)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:892386..894497
Genome map
AA seq 703 aa AA seqDB search
MGRDLQNHLLFEVATEVANRVGGIYSVLKSKAPITSAQYKENYALIGPLNKATYQSEVEE
LDWQDESIFTDELKPIHKTLKSMSEKGFYFVYGKWLIDGYPKVILFDLDSMRHNLNNWKS
DLWSLVGIPSPDHDSETNDAIMLGYTVAWFLGELSTSDSQHAIVAHFHEWLAGVALPLCR
KKKIDVVTIFTTHATLLGRYLCAAGDVDFYNNLQHFDVDQEAGKRGIYHRYCIERAAAHT
ADVFTTVSQITALEAEYLLKRKPDGILPNGLNVVKFQAVHEFQNLHALKKEKIHDFIRGH
FHGNFDFDLKNTLYFFIAGRYEYKNKGADMFIEALARLNYRLKMSGSNKTVVAFIIMPAK
TNSYTVEALKNQAAVKSLESSVNEVTKNISKRIFDHALKFPHNGITTEIPTDLTELLSSS
DQILLKRRVMALRRTENQLPAVVTHNMADDASDPILTQIRHVQLFNSTSDRVKVIFHPDF
LNANNPILGMDYDEFVRGCHLGVFPSYYEPWGYTPAECTVMGVPSITTNLSGFGAYMEDL
IEANQAQDYGIYIVDRRFKSPDESVEQLVDYMEEFVKKNIRQRINQRNRTERLSDLLDWR
RMGLEYVKARQLALRRAYPEQFKQMVGEELNATDMNSMVGGKKLKISRPLSVPGSPKDRA
SSTTVFMTPGDLGTLQDANNADDYFNLSMNPEDAQDDEADEEY
NT seq 2112 nt NT seq  +upstreamnt  +downstreamnt
atgggtcgtgacttacaaaatcatctactttttgaggttgccactgaggtggcaaataga
gtcggtggtatctactccgttttaaaatcaaaagcaccaattacttcagcacaatacaag
gaaaactatgcattaattggtccattgaacaaggcaacataccaaagtgaagttgaggaa
ttggattggcaggatgaatccatattcacagatgaattaaagcctattcataagactttg
aagagtatgagtgaaaaaggtttttactttgtctacggtaaatggttaattgatggatat
ccaaaagttattcttttcgatttagattccatgagacataatttgaacaattggaaatcc
gatttgtggtctttggtcggaattccttccccagatcatgattctgaaacaaatgatgcc
attatgttgggttacacagtggcatggtttcttggtgaactttcaacttctgacagtcaa
cacgctatcgttgcccatttccatgaatggctagctggtgttgcactacctttatgtcgt
aaaaagaaaattgatgtggtcactattttcactacacacgcaactctattaggtagatat
ctttgtgcggctggtgacgtggatttctacaataatttacaacattttgacgtagatcaa
gaagcaggcaaaagaggaatctatcatagatattgcattgaaagagctgctgcgcataca
gccgatgttttcaccactgtttcacaaattacagcattagaagctgaatacttattgaaa
agaaaaccagacggtatcttgccaaatggtctaaatgtcgttaaatttcaggctgtacat
gagttccaaaatttgcatgccctcaagaaagaaaagattcatgacttcattagaggccat
ttccatggtaattttgattttgacttgaaaaataccctttatttcttcattgcaggtaga
tatgaatataaaaataaaggtgctgatatgttcattgaagctttggcccgtctaaactac
agattaaaaatgtctggttctaataagaccgttgtagcattcattattatgcctgctaag
acaaactcttatactgttgaagctttgaaaaaccaagctgctgtcaaatctttagaaagc
tccgttaacgaagttacgaagaatatcagtaagagaatattcgaccatgcattaaaattc
cctcataacggtataacaacggaaattccaactgatctgactgaattgttaagctcatct
gatcaaattctattgaagagaagagttatggctctaagacgaacagaaaatcaattgcca
gccgtcgtaacacataatatggcagatgatgctagcgatccaattttgactcaaataaga
cacgtccaattatttaatagcacaagtgatagagttaaagttatttttcatcctgatttt
ttaaatgcaaacaatccaattcttggtatggactacgacgaattcgttcgtggttgtcat
ttaggtgtattcccatcatactatgagccatggggttatactccagcagaatgtactgtc
atgggtgttccatcgataactacaaacctttccggttttggtgcttatatggaagacttg
atagaagccaaccaagctcaggattatggtatctatattgttgatagaagatttaagagt
cctgatgaatctgttgaacagttagttgattatatggaagagtttgtcaagaaaaatata
agacaaagaattaatcaaagaaatagaacagaaagactatctgatcttttggattggaga
agaatgggtctagaatatgttaaagctaggcagttggccctaagaagagcatacccggaa
caattcaagcaaatggtaggcgaagaattgaatgctactgatatgaactccatggttggt
ggtaagaaattaaagatttctagacctttgagtgttccaggatcgccaaaagacagggct
agcagcactactgtttttatgacgccaggtgatttaggtaccttacaagatgctaacaac
gctgatgattactttaatttgagtatgaatccagaagatgctcaggatgatgaagccgat
gaggaatattga

DBGET integrated database retrieval system