KEGG   Kazachstania africana: KAFR_0D00420Help
Entry
KAFR_0D00420      CDS       T02487                                 

Gene name
KAFR0D00420
Definition
hypothetical protein
Orthology
K14152  
phosphoribosyl-ATP pyrophosphohydrolase / phosphoribosyl-AMP cyclohydrolase / histidinol dehydrogenase [EC:3.6.1.31 3.5.4.19 1.1.1.23]
Organism
kaf  Kazachstania africana
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:kaf01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:kaf00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4:complement(60057..62420)
Genome map
AA seq 787 aa AA seqDB search
MTFPILPIFGKDIDNVLIDKPFLKLAGQAVLDASEFATDADILAAAKKCSNNFKSISIFL
DSVEQFNEKELINILNNGVDKIYSIKQITFESIPPSRLVSNIPTGLARADDMSLDAFSEA
VLSKLKSDRKDGLYTTLVVDEAERCLGLVYSSKESIALAIKKERGIYFSRSRNEIWEKGA
TSGNTQKLISVDLDCDSDALKFIVGQDGVGFCHLETESCFGNFSYGLVELEKTLLNRLSN
AVEGSYTRRLFSDEELLNAKIKEEAEELVEAKGKDEISWEAADLFYFIMTKLVSCGVSLK
DVENNLNMKNLKITRRKGDAKPKFLKKKEDSIVEKKLKIDTSKDEPVFLQVVESSDIEGV
QGAVTRPIQKTSEIMHLVQPIIENVKTNGDKALLEYTEKFDGVKLTSTCIEAPIPEEYFE
GLTDEMKNSLDLSIENVRKFHAAQLQEEPMVVETQPGVVCSRFPRPIERVGLYIPGGTAI
LPSTALMLGVPAQVAGCKEIVFASPPCKSDGKISPEVAYVASKVGASKIVLAGGAQAVAA
MAYGTESVPKVDKILGPGNQFVTAAKMHVQNDTQALCSIDMPAGPSEVLVVADEDADEDF
VASDLLSQAEHGIDSQVILVGVNLSKAKIDRIQQAVHSQALELPRLEIVRKCITHSTIIL
CKSYQEAIEMSNKYAPEHLILQINNANDYVKLVDNAGSIFVGAYTPESCGDYSSGTNHTL
PTYGYARQYSGCNTSTFQKFITAQSITPEGLDKIGRAVMCIAKVEGLDGHRNAVKIRMNK
LGLLPKV
NT seq 2364 nt NT seq  +upstreamnt  +downstreamnt
atgacgttccctattttaccaatatttgggaaagacattgacaatgttttaatagacaaa
ccttttttgaaattagctggtcaagcagtattagacgcctctgaatttgcgacagacgct
gacatcttagctgcagctaagaaatgtagtaacaactttaaatctatttccattttcttg
gattctgtggaacaattcaatgaaaaagaactcataaatattttaaacaacggagttgat
aaaatttactctattaagcaaatcacttttgagtctatcccgcctagtagacttgttagt
aacatcccaaccggcttggctagggcagatgacatgtccctcgatgccttcagtgaagct
gttttatctaagctgaagagtgatagaaaggatggattgtacacaactctggttgttgac
gaggccgaacgctgccttggtttagtatattcctcaaaggagtcaattgcattagctatt
aagaaagaacgtggtatttacttttcaaggtctagaaatgaaatttgggaaaaaggtgcc
acttcaggcaatactcaaaaattgatctctgttgacttagattgtgactctgatgcttta
aagtttattgtcggtcaggatggagtcggtttttgccacttagaaactgaatcatgcttt
ggaaatttcagttacggtttggtcgaactcgagaagactttattaaacaggttgagtaat
gctgttgaaggttcttatacaagacgccttttcagcgatgaggaactgttaaatgccaaa
attaaagaggaagctgaggaattggttgaagccaagggtaaagatgaaatttcatgggag
gcagctgatttattttattttataatgacaaaattagtttcctgtggtgtttcattaaag
gatgttgaaaataatttgaacatgaagaatcttaagattacaagaagaaaaggtgatgct
aaacctaagtttttgaagaaaaaagaggattcaattgtggaaaagaaattaaaaatcgat
acttcaaaggatgaacccgtctttctacaagtggtagaatcaagtgatatcgagggtgtt
caaggtgcagttactagaccaatccaaaagacctctgagattatgcatcttgtccaacct
attatcgagaatgtcaagactaatggtgataaagccctccttgaatatacagaaaagttc
gatggcgtgaaattaacaagtacttgtatcgaagcgccaatccctgaagaatatttcgaa
ggtttgaccgatgaaatgaagaattctttggatctctccattgaaaacgttcgtaaattc
cacgctgctcaactacaagaggaacctatggttgttgaaactcaaccaggcgttgtttgt
tcaagatttccgagaccaattgaaagggttggtctctatattccaggtggtactgctatt
ttaccgagtacagcattaatgttgggggtcccggcacaggttgctggctgcaaagaaatt
gtatttgcctcacctccttgtaaatcggatgggaaaatttcacctgaagttgcgtatgtg
gcttcaaaagttggtgcatccaaaattgttcttgccggtggtgctcaagctgttgctgcg
atggcgtatggtaccgaatctgttccaaaggttgataaaatattaggtccaggtaaccaa
tttgtcacagcggctaaaatgcatgtacaaaacgatacgcaggcattatgttcgattgat
atgccagcgggtcctagtgaagttttagttgttgccgatgaagatgcagatgaggatttt
gtcgccagtgatttgctttcacaagctgaacatggtattgattcccaagttattcttgtg
ggtgtaaatttgagcaaagctaagattgacagaattcaacaagcagttcactcccaggca
ctagaattacctagattggaaattgtgcgcaaatgtatcactcacagtacaataatactg
tgtaaaagttatcaagaggcaattgaaatgtcgaataagtatgctccagaacatttaatc
ctacagatcaataatgcgaatgactacgtaaagttggtagacaatgccggtagtattttt
gtcggtgcttacacaccagaatcatgtggtgactattcgagtggtacaaatcatacattg
cctacctacggttatgcaagacagtacagtggttgcaacacttctactttccagaaattt
atcactgcgcaaagcattacgccagaaggtttggataaaatcggcagagcagtgatgtgt
attgccaaggttgaaggtttagatggacacagaaatgcagtcaagatccgaatgaacaaa
ttgggccttctaccaaaggtctga

DBGET integrated database retrieval system