KEGG   Kazachstania africana: KAFR_0D01920Help
Entry
KAFR_0D01920      CDS       T02487                                 

Gene name
KAFR0D01920
Definition
hypothetical protein
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
kaf  Kazachstania africana
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:kaf00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    KAFR_0D01920 (KAFR0D01920)
Enzymes [BR:kaf01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     KAFR_0D01920 (KAFR0D01920)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4:389163..389900
Genome map
AA seq 245 aa AA seqDB search
MSEDHERINNLRYENNATPLNQKPTSPYTLNPPVEHDGLSWPSLGARIRSEEDSIEEQAR
VDRIGNAIKVILEELGEDPSREGLLDTPQRYAKAMLFFTKGYQTNIIDDVIKNAVFEEDH
NEMVIVRDIEIYSLCEHHLVPFFGKVHIGYIPNKKVIGLSKLARLAEMYARRLQVQERLS
KQIAMALQDILKPMGVAVVIEATHMCMVSRGIEKTGSSTITSSMLGCFRAHKTREEFLSL
LNKRF
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaagatcatgaaaggataaataacttaagatacgagaataatgcgactccttta
aatcagaaaccaacttccccatatactctaaatccgccagtcgagcatgatggcctctct
tggccgagtctaggtgctagaataagatctgaagaggattcaatagaggaacaggcaaga
gtagatcgtataggcaacgccattaaagtaatattagaagaactgggtgaagatccgagt
agagaaggtttactcgacacaccacagcgttatgctaaagctatgttattctttacaaaa
ggttatcaaactaatattattgatgatgtcattaaaaatgcagtgtttgaagaagatcac
aacgaaatggtcattgtacgtgacattgaaatatattccctatgtgaacatcatttagta
ccatttttcggaaaggttcacattggctatatcccaaataagaaagtaattggtctcagt
aaattagctcgtttagctgaaatgtacgcaagaagattgcaagttcaagaacgtttatcc
aaacaaattgcaatggctttacaagatattttgaaaccaatgggggtagctgtggtaatt
gaagcaactcacatgtgcatggtatcgagaggtatcgagaaaactggatcttctacaatt
acttcatccatgctgggttgttttagagcacataaaactagagaagagtttttaagcctt
ctaaacaaaagattttaa

DBGET integrated database retrieval system