KEGG   Kazachstania africana: KAFR_0E00640Help
Entry
KAFR_0E00640      CDS       T02487                                 

Gene name
KAFR0E00640
Definition
hypothetical protein
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
kaf  Kazachstania africana
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:kaf00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    KAFR_0E00640 (KAFR0E00640)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    KAFR_0E00640 (KAFR0E00640)
Enzymes [BR:kaf01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     KAFR_0E00640 (KAFR0E00640)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5:141943..142929
Genome map
AA seq 328 aa AA seqDB search
MTKTDQPHYKYYKDQQLSIIKAPFCGGQAKLGVEKGPRYLLKAGLESDLNGLGWNTIIES
PLDESEIRQQMVADDPTDKYLNAKRPRFVGESNEKIYNCIKEKVLAFDRFPLTIGGDHSI
GMATVSATLEKFPNAGLLWVDAHTDIHTIETTDTGNIHGCPVSFLLGLNKNLNGVPKSFD
WVPGNLRPEKIAYIGLRSVDPAERKILRDLGISAFSMYHIDKFGINKVIEMALESIHPDT
NGDGPIICSFDVDAIDPLFVPATGVPVKGGLTLREGLFVAERLAETGNLVSLDVVECNPE
LVTDGKHLFDSVEAGCAIARCALGETLL
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagactgatcagcctcattacaaatactacaaagatcaacaactctccattata
aaggcgcccttctgtggaggtcaagcgaaattgggtgtcgaaaagggtcctcggtatctt
ttaaaagctggtttggaatccgatttaaatggtctaggttggaatactatcatcgaatct
ccattagatgaatcggaaattagacaacaaatggttgctgatgatcctactgataaatat
ctaaatgcaaagagaccaaggttcgttggtgaaagtaacgaaaaaatttacaactgtatc
aaagaaaaagtcttagcattcgatagattcccattgactatcggtggtgatcattccatc
ggtatggcaacagtctctgctactctggaaaaattcccaaacgcaggtttactctgggtt
gacgctcataccgatattcataccattgaaactaccgatactggtaacattcatggttgt
ccagtttcatttctattaggcttaaacaaaaacttaaatggcgtcccaaaatcctttgat
tgggtaccaggtaatttaagaccagaaaaaattgcatatattggtctaagatctgttgat
cctgctgaaagaaaaatcttgagagatttaggtatatctgcattctcaatgtatcatatc
gataaattcggtataaacaaagtcattgaaatggctttagaatctattcatccagacact
aacggtgatggtccaattatctgttcctttgacgttgatgccatcgatccccttttcgta
ccagccactggtgtcccagttaaaggtggtctaactttaagagaaggtttattcgtagca
gaaagattagccgaaactggtaacctggtcagtttagacgttgtcgaatgcaaccctgaa
ttggtcacagacgggaaacatttattcgattccgttgaagcaggctgtgccattgcaaga
tgcgctctaggtgaaacattgctctga

DBGET integrated database retrieval system