KEGG   Kazachstania africana: KAFR_0E00640Help
Entry
KAFR_0E00640      CDS       T02487                                 

Gene name
KAFR0E00640
Definition
hypothetical protein
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
kaf  Kazachstania africana
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:kaf01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:kaf00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5:141943..142929
Genome map
AA seq 328 aa AA seqDB search
MTKTDQPHYKYYKDQQLSIIKAPFCGGQAKLGVEKGPRYLLKAGLESDLNGLGWNTIIES
PLDESEIRQQMVADDPTDKYLNAKRPRFVGESNEKIYNCIKEKVLAFDRFPLTIGGDHSI
GMATVSATLEKFPNAGLLWVDAHTDIHTIETTDTGNIHGCPVSFLLGLNKNLNGVPKSFD
WVPGNLRPEKIAYIGLRSVDPAERKILRDLGISAFSMYHIDKFGINKVIEMALESIHPDT
NGDGPIICSFDVDAIDPLFVPATGVPVKGGLTLREGLFVAERLAETGNLVSLDVVECNPE
LVTDGKHLFDSVEAGCAIARCALGETLL
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagactgatcagcctcattacaaatactacaaagatcaacaactctccattata
aaggcgcccttctgtggaggtcaagcgaaattgggtgtcgaaaagggtcctcggtatctt
ttaaaagctggtttggaatccgatttaaatggtctaggttggaatactatcatcgaatct
ccattagatgaatcggaaattagacaacaaatggttgctgatgatcctactgataaatat
ctaaatgcaaagagaccaaggttcgttggtgaaagtaacgaaaaaatttacaactgtatc
aaagaaaaagtcttagcattcgatagattcccattgactatcggtggtgatcattccatc
ggtatggcaacagtctctgctactctggaaaaattcccaaacgcaggtttactctgggtt
gacgctcataccgatattcataccattgaaactaccgatactggtaacattcatggttgt
ccagtttcatttctattaggcttaaacaaaaacttaaatggcgtcccaaaatcctttgat
tgggtaccaggtaatttaagaccagaaaaaattgcatatattggtctaagatctgttgat
cctgctgaaagaaaaatcttgagagatttaggtatatctgcattctcaatgtatcatatc
gataaattcggtataaacaaagtcattgaaatggctttagaatctattcatccagacact
aacggtgatggtccaattatctgttcctttgacgttgatgccatcgatccccttttcgta
ccagccactggtgtcccagttaaaggtggtctaactttaagagaaggtttattcgtagca
gaaagattagccgaaactggtaacctggtcagtttagacgttgtcgaatgcaaccctgaa
ttggtcacagacgggaaacatttattcgattccgttgaagcaggctgtgccattgcaaga
tgcgctctaggtgaaacattgctctga

DBGET integrated database retrieval system