KEGG   Kazachstania africana: KAFR_0E00820Help
Entry
KAFR_0E00820      CDS       T02487                                 

Gene name
KAFR0E00820
Definition
hypothetical protein
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
kaf  Kazachstania africana
Brite
Enzymes [BR:kaf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     KAFR_0E00820 (KAFR0E00820)
Transfer RNA biogenesis [BR:kaf03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    KAFR_0E00820 (KAFR0E00820)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5:complement(167726..169393)
Genome map
AA seq 555 aa AA seqDB search
MGRRGKGPKTNNQKLAPEKERFIQCCGDVTLELTNSLTSSKEINLNGLITKFSKKYKLKQ
QPRLTDIINSIPDQYKKYLLPKLKAKPVRTASGIAVVAVMCKPHRCPHIAYTGNICVYCP
GGPDSDFEYSTQSYTGYEPTSMRAIRARYDPYEQARGRVEQLKQLGHSIDKVEYVVMGGT
FMSLPIDYREDFITKLHNALSGFNGNDLDEAIKYSQQSLTKCVGITIETRPDYCTETHLD
DMLRYGCTRLEIGVQSLYEDVARDTNRGHTVKSVCETFAIAKDAGYKVVSHMMPDLPNVG
MERDIEQFKEYFENPGFRTDGLKIYPTLVIRGTGLYELWKTGRYKSYNANALVDLVARIM
ALVPPWTRIYRVQRDIPMPLVTSGVDNGNLRELALARMKDLGTKCRDIRTREVGIQEVHH
KVSPDQVELIRRDYYANGGWETFLSYEDPKKDILVGLLRLRKASKKYTYRKEFTSQRTSI
VRELHVYGSVVPLHSRDPRKFQHQGFGTLLMEEAERIAREEHGSEKISVISGVGVRNYYA
RLGYELDGPYMSKHI
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgggacgtcgtggtaaagggccaaaaactaataatcaaaaacttgctccggaaaaggag
cgttttattcaatgttgtggtgatgtgacgttggagctgacaaattcattaacttcctca
aaagaaatcaatctaaatggattaattaccaagttttctaaaaaatacaagctgaagcaa
caaccaagattaactgacattattaattctattcctgatcaatacaagaagtatttactg
ccaaaattaaaagcaaaacctgttagaacggcatctggtattgctgttgttgctgtcatg
tgtaagccacatcgttgtccacatattgcatatacggggaacatttgtgtatattgccct
ggtggtccagattcagatttcgaatattcaacacaatcatatacagggtacgaacctact
tcgatgagagccattagagctcgatatgacccgtacgaacaagcacgtgggagagtagaa
caattaaaacaactgggtcattctatagataaagtggagtatgtcgttatgggtggtacc
ttcatgtcattacctatagattatcgtgaagattttattactaagctacataatgctctt
tctgggttcaacggtaacgacctagacgaagccatcaaatattcacaacaaagtttaaca
aagtgtgtcgggatcactattgaaaccagacccgactactgtaccgaaacccatcttgat
gatatgttaagatatggatgtactagattagaaattggtgttcaatcgttatatgaagat
gtggcgagagatacaaatagaggccatacagtcaaatctgtttgtgaaacatttgccata
gctaaagatgcaggttataaagttgtctcgcatatgatgcctgatctaccaaatgttgga
atggaaagagatattgaacaatttaaggaatattttgaaaatccaggtttcagaactgac
ggtttgaagatttatccaactttggtcattagaggaaccggtttatacgaattatggaaa
actggtagatacaagtcgtataatgctaatgcattagtcgatttagtggccagaattatg
gctcttgtccctccctggaccagaatttatcgtgttcaaagagatatcccaatgcctcta
gttacatccggtgttgataatggtaatctaagagaattagctttggcaagaatgaaggat
cttggtactaaatgtagagatattcgtacaagagaggtcggtattcaagaagttcatcat
aaagtgtcgccagaccaagttgaattgattagaagagattattatgcaaacggtggctgg
gaaactttcttatcatatgaagatccaaagaaagatatcttggttggtttattaagacta
agaaaggcttctaagaagtatacatacagaaaggaattcacatcacagagaacgtccatt
gttagagaattacacgtttacggatctgttgttccactacattccagagatccgcgtaag
ttccaacatcaaggctttggtactttattgatggaagaagctgaaagaatcgccagagag
gaacatggctctgagaagatttctgttatctcaggtgttggtgtcagaaattattatgca
agattaggttatgagttagacggtccatatatgtccaagcatatttaa

DBGET integrated database retrieval system