KEGG   Kazachstania africana: KAFR_0E01330Help
Entry
KAFR_0E01330      CDS       T02487                                 

Gene name
KAFR0E01330
Definition
hypothetical protein
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
kaf  Kazachstania africana
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:kaf01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:kaf00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5:268000..269277
Genome map
AA seq 425 aa AA seqDB search
MTEKKKYTIVIKLGSSSLVDEKTKEPKLAIMSLIVETVVKLRREGHRVIIVSSGGIAIGL
RTMNMDKRPKRLAEIQAIAAVGQGRLIGRWDLLFSQFGQRIAQILLTRNDILDWTQYKNA
QNTINELLDLGVVPIVNENDTLSIREIKFGDNDTLSAITSALVGADYLVLLTDVDCLYTD
NPRTNPDAKPIVIVPDLSQGLPGVNTASGSGSDVGTGGMATKLIAADLATNAGTHTIIMK
STVPANLCKVVEYMQNLDMDSNSARDKYKSCDIWDLQQQEFERLIKLDVPLHTKFIANDT
KHHLKNREFWILHGLVAKGSIIIDQGAYLALTRKDKAGLLPAGVIDVEGSFHDLECVDIK
IGKRLPNRELDTSSPLKIVGRARCNYTSVEIAKIKGLQSDEIEDILGYIDSEYIARRENL
AFPPH
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgactgagaagaagaaatatactattgttatcaaattgggctcgtcttctttggtggac
gagaagacgaaggagccaaaattggcgattatgtcactgatcgtggaaaccgtggtaaag
ttgagacgggagggtcacagggtgattattgtctctagtggtggtattgctattgggcta
cggacgatgaacatggataagagaccaaaacgtctcgcagagattcaagctattgcagct
gtgggtcaaggtagacttatcggtagatgggatcttttattctctcaatttggtcagaga
atcgcccagattcttttgactagaaacgatatcctcgattggacccagtataagaacgct
cagaacactatcaatgagttattagatctaggtgtcgttccaatcgttaatgaaaacgat
actttatcaatccgtgagattaaattcggtgataatgatacattatcagccattacctca
gcgcttgttggtgccgactacttggttctactcactgatgtggactgtctatatacagac
aatccaagaacaaacccagacgctaaaccaatagtgatcgttccagatttatctcaaggt
ttgccaggtgtaaatactgcaagcggttcgggttctgacgtcggtacaggtggtatggcc
accaaattaattgctgcagacttggctacgaatgcaggtacacacacgattatcatgaaa
agtacggttccagcaaatctttgtaaagttgtagagtacatgcaaaatctcgatatggat
tctaattctgcaagagataaatataaaagctgtgacatatgggacttgcaacaacaggaa
ttcgaaagattaatcaaattagatgttccacttcacactaaatttattgctaatgacacc
aaacatcatttgaaaaacagagaattctggatattgcacggccttgtcgctaaaggttcc
atcattatcgatcagggcgcatatctcgctttaacacgtaaggataaagctggtttatta
ccagctggtgtcattgacgtcgaaggatcattccatgatttagaatgtgtcgatatcaaa
attggtaaaagactgccaaatagagagctagacacatcaagtcctttgaaaattgttgga
agagctagatgtaattacactagtgttgaaattgccaagataaagggcctacaaagtgat
gaaattgaagatattttaggctatattgacagtgaatacattgcacgtagagaaaatttg
gctttccctcctcattaa

DBGET integrated database retrieval system