KEGG   Kazachstania africana: KAFR_0E01330Help
Entry
KAFR_0E01330      CDS       T02487                                 

Gene name
KAFR0E01330
Definition
hypothetical protein
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
kaf  Kazachstania africana
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:kaf00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    KAFR_0E01330 (KAFR0E01330)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    KAFR_0E01330 (KAFR0E01330)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    KAFR_0E01330 (KAFR0E01330)
Enzymes [BR:kaf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     KAFR_0E01330 (KAFR0E01330)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5:268000..269277
Genome map
AA seq 425 aa AA seqDB search
MTEKKKYTIVIKLGSSSLVDEKTKEPKLAIMSLIVETVVKLRREGHRVIIVSSGGIAIGL
RTMNMDKRPKRLAEIQAIAAVGQGRLIGRWDLLFSQFGQRIAQILLTRNDILDWTQYKNA
QNTINELLDLGVVPIVNENDTLSIREIKFGDNDTLSAITSALVGADYLVLLTDVDCLYTD
NPRTNPDAKPIVIVPDLSQGLPGVNTASGSGSDVGTGGMATKLIAADLATNAGTHTIIMK
STVPANLCKVVEYMQNLDMDSNSARDKYKSCDIWDLQQQEFERLIKLDVPLHTKFIANDT
KHHLKNREFWILHGLVAKGSIIIDQGAYLALTRKDKAGLLPAGVIDVEGSFHDLECVDIK
IGKRLPNRELDTSSPLKIVGRARCNYTSVEIAKIKGLQSDEIEDILGYIDSEYIARRENL
AFPPH
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgactgagaagaagaaatatactattgttatcaaattgggctcgtcttctttggtggac
gagaagacgaaggagccaaaattggcgattatgtcactgatcgtggaaaccgtggtaaag
ttgagacgggagggtcacagggtgattattgtctctagtggtggtattgctattgggcta
cggacgatgaacatggataagagaccaaaacgtctcgcagagattcaagctattgcagct
gtgggtcaaggtagacttatcggtagatgggatcttttattctctcaatttggtcagaga
atcgcccagattcttttgactagaaacgatatcctcgattggacccagtataagaacgct
cagaacactatcaatgagttattagatctaggtgtcgttccaatcgttaatgaaaacgat
actttatcaatccgtgagattaaattcggtgataatgatacattatcagccattacctca
gcgcttgttggtgccgactacttggttctactcactgatgtggactgtctatatacagac
aatccaagaacaaacccagacgctaaaccaatagtgatcgttccagatttatctcaaggt
ttgccaggtgtaaatactgcaagcggttcgggttctgacgtcggtacaggtggtatggcc
accaaattaattgctgcagacttggctacgaatgcaggtacacacacgattatcatgaaa
agtacggttccagcaaatctttgtaaagttgtagagtacatgcaaaatctcgatatggat
tctaattctgcaagagataaatataaaagctgtgacatatgggacttgcaacaacaggaa
ttcgaaagattaatcaaattagatgttccacttcacactaaatttattgctaatgacacc
aaacatcatttgaaaaacagagaattctggatattgcacggccttgtcgctaaaggttcc
atcattatcgatcagggcgcatatctcgctttaacacgtaaggataaagctggtttatta
ccagctggtgtcattgacgtcgaaggatcattccatgatttagaatgtgtcgatatcaaa
attggtaaaagactgccaaatagagagctagacacatcaagtcctttgaaaattgttgga
agagctagatgtaattacactagtgttgaaattgccaagataaagggcctacaaagtgat
gaaattgaagatattttaggctatattgacagtgaatacattgcacgtagagaaaatttg
gctttccctcctcattaa

DBGET integrated database retrieval system