KEGG   Kazachstania africana: KAFR_0E01430Help
Entry
KAFR_0E01430      CDS       T02487                                 

Gene name
KAFR0E01430
Definition
hypothetical protein
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
kaf  Kazachstania africana
Brite
Enzymes [BR:kaf01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     KAFR_0E01430 (KAFR0E01430)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5:complement(288175..290214)
Genome map
AA seq 679 aa AA seqDB search
MFMNPADLAVLFAVIIAVVTYKCFDKIKSFLSFDDSSVTIHSSSRDIAAVLEENDKNYLV
LYGSQTGTTEDYARKFSKELAAKFGLNVMCVDVENYDFDTLNELPDNVLVSLFFSTYGEG
DFPDGAVNFEEFLNSASDDTLNNVKFTLFGFGNSTYEFFNGAAEKALKGLTAAGATLIGR
MGEADDGKDSTDEDYLTWKEEIFDELKNYLNLDEQDSGFKASFELTKLNSVDNGTSLGEP
SIKYLPANKLSYNSDGQQMGPFDPSHPYISPIVKSHELFKSLDRNCIHTEFDISDSDMTY
TTGDHLAIWPSNAVEKVDQFLSVFNLLPDTVFNLKPHDSTIDLPFPCPTTIGAAVKHYIE
ITGPISRQSFSLLAEFAPKEIKEYVAKLAKDKDAFHKEITSKNFNLADALYYLSQGKPWT
EVPWEFLLETIPHLQPRYYSISSSSKSEPTVVHVTSIVENTSNPLTGSPTVGVTTNLLRN
IQMAKSSQNTKLLPVTYDLNGPRNLFADYKLPIHVRHSAFKLPNDLSVPVIMIGPGTGVA
PFRGFVRERVHLMESGQPTSGKMMLFYGSRDETDFLYENEWPEYSQKLDGSFEMVVAFSR
TQKEKIYVQHKMQERKKDIYDLLDKGAHVYVCGDASRMAKDVQKTIAEILVEFRNVSEPT
ASEIIKNMKLAGKYQEDVW
NT seq 2040 nt NT seq  +upstreamnt  +downstreamnt
atgttcatgaatcctgctgatctggcggtcctttttgcggtaatcattgctgtggtgact
tataaatgcttcgataagatcaaatcattcctgtcttttgacgattcgtcagtaacaatc
cattcttcatcccgtgacattgctgctgtattagaggaaaacgacaagaattacttggtt
ctctacggttcacaaactggtaccaccgaggattatgccaggaaatttagtaaagagtta
gctgcaaaatttggtctaaatgtaatgtgtgtcgatgtagaaaattacgacttcgataca
ttgaacgagttacctgataacgtccttgtctcacttttcttttcaacttatggtgaaggc
gatttcccagacggtgcagtcaattttgaagaattcttaaactcagcatccgatgatact
ttaaataatgttaaattcactctatttggttttggtaacagcacttacgaatttttcaat
ggtgcagctgaaaaggccttaaagggtttaactgcagcaggtgctactttaatcggtaga
atgggagaagctgatgacggtaaggactctactgatgaagattacttgacttggaaagaa
gagatttttgatgaattgaaaaattacttaaatttggacgaacaggattctggtttcaaa
gcctcttttgagttaactaaattgaatagcgtcgacaacggcacatctctcggtgaacct
tccataaagtatttgccggctaacaagttatcatacaattcggacgggcaacaaatgggt
ccattcgacccttcgcatccttatatttctccaattgtaaaatcacatgaattattcaaa
agtctagatcgtaactgtattcatactgaattcgatatttctgactctgatatgacttac
actactggtgatcatttagccatatggccatctaatgcagttgaaaaagttgaccagttt
ttgtctgtcttcaatttgctacctgatactgtatttaatcttaagccacatgattctacc
attgacttaccattcccatgtcctaccaccattggtgccgctgtgaaacattatattgaa
attactggtccaatctcaagacaaagtttttcactcttagctgaatttgctccaaaggaa
attaaagaatacgttgcaaaactagcaaaggataaggacgcattccacaaagagattaca
tcgaaaaatttcaatttagctgatgcactatactatttgtcacaaggtaagccatggaca
gaagtcccatgggaattcttactagaaaccattccacatttacagccacgttattattcc
atctcatcatcatctaaatccgaaccaactgtcgtccatgtaacttccatcgttgaaaac
acatctaatcctttaactggctctccaactgttggtgtcacgaccaaccttctaagaaac
attcaaatggcaaagtcatcacaaaatacaaaacttcttcctgttacttatgatctaaat
ggcccacgtaacctttttgccgactataaattacctattcatgtccgccattctgccttc
aaattaccaaatgatttgtccgttccagtcataatgattggtcctggtactggtgtggct
ccattccgtggttttgttagggaacgtgttcatttgatggaatctggtcagccaacctca
ggtaaaatgatgctattttatggttcaagagatgaaacagattttctatacgaaaacgaa
tggcctgaatacagtcaaaaattggatggatcttttgaaatggttgtggcattttcgaga
acccaaaaggagaaaatatacgtacaacataagatgcaagaacgtaagaaagatatatat
gatttgctagacaagggtgcccacgtatatgtttgtggagatgcttccagaatggctaag
gatgtccaaaagacgattgcagaaatcctcgtcgaatttagaaatgtgtcagaacccaca
gctagtgaaattatcaagaatatgaaacttgcaggtaaatatcaagaagatgtatggtaa

DBGET integrated database retrieval system